CEP55 Antibody


Western Blot: CEP55 Antibody [NBP1-53039] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CEP55 Antibody Summary

Synthetic peptides corresponding to CEP55(centrosomal protein 55kDa) The peptide sequence was selected from the middle region of CEP55. Peptide sequence TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CEP55 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CEP55 Antibody

  • C10orf3
  • cancer/testis antigen 111
  • centrosomal protein 55kDa
  • centrosomal protein of 55 kDa
  • Cep55
  • chromosome 10 open reading frame 3
  • CT111
  • FLJ10540
  • Up-regulated in colon cancer 6
  • URCC6


CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
Species: Hu
Applications: WB, ICC/IF, IP, PLA, ICC, IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: IHC, IHC-P

Publications for CEP55 Antibody (NBP1-53039) (0)

There are no publications for CEP55 Antibody (NBP1-53039).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP55 Antibody (NBP1-53039) (0)

There are no reviews for CEP55 Antibody (NBP1-53039). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CEP55 Antibody (NBP1-53039) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CEP55 Products

Bioinformatics Tool for CEP55 Antibody (NBP1-53039)

Discover related pathways, diseases and genes to CEP55 Antibody (NBP1-53039). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP55 Antibody (NBP1-53039)

Discover more about diseases related to CEP55 Antibody (NBP1-53039).

Pathways for CEP55 Antibody (NBP1-53039)

View related products by pathway.

PTMs for CEP55 Antibody (NBP1-53039)

Learn more about PTMs related to CEP55 Antibody (NBP1-53039).

Blogs on CEP55

There are no specific blogs for CEP55, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CEP55 Antibody and receive a gift card or discount.


Gene Symbol CEP55