CEP55 Antibody - BSA Free

Western Blot: CEP55 Antibody [NBP1-53039] - Human Lung lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CEP55 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CEP55(centrosomal protein 55kDa) The peptide sequence was selected from the middle region of CEP55. Peptide sequence TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CEP55
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CEP55 Antibody - BSA Free

• C10orf3
• cancer/testis antigen 111
• centrosomal protein 55kDa
• centrosomal protein of 55 kDa
• Cep55
• chromosome 10 open reading frame 3
• CT111
• FLJ10540
• Up-regulated in colon cancer 6
• URCC6

Background

CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CEP55
• Uniprot:
  • Q53EZ4(Human)