CEP55 Antibody

Images

 
Western Blot: CEP55 Antibody [NBP1-53039] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEP55 Antibody Summary

Immunogen
Synthetic peptides corresponding to CEP55(centrosomal protein 55kDa) The peptide sequence was selected from the middle region of CEP55. Peptide sequence TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEP55
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CEP55 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CEP55 Antibody

  • C10orf3
  • cancer/testis antigen 111
  • centrosomal protein 55kDa
  • centrosomal protein of 55 kDa
  • Cep55
  • chromosome 10 open reading frame 3
  • CT111
  • FLJ10540
  • Up-regulated in colon cancer 6
  • URCC6

Background

CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-38986
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-20605
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CEP55 Antibody (NBP1-53039) (0)

There are no publications for CEP55 Antibody (NBP1-53039).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP55 Antibody (NBP1-53039) (0)

There are no reviews for CEP55 Antibody (NBP1-53039). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CEP55 Antibody (NBP1-53039) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEP55 Products

Bioinformatics Tool for CEP55 Antibody (NBP1-53039)

Discover related pathways, diseases and genes to CEP55 Antibody (NBP1-53039). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP55 Antibody (NBP1-53039)

Discover more about diseases related to CEP55 Antibody (NBP1-53039).
 

Pathways for CEP55 Antibody (NBP1-53039)

View related products by pathway.

PTMs for CEP55 Antibody (NBP1-53039)

Learn more about PTMs related to CEP55 Antibody (NBP1-53039).

Blogs on CEP55

There are no specific blogs for CEP55, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEP55 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP55
Uniprot