Centrin 3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Centrin 3 Antibody [NBP3-38508] - Immunofluorescence analysis of L929 cells using Centrin 3 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Centrin 3 Antibody [NBP3-38508] - Immunofluorescence analysis of C6 cells using Centrin 3 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Centrin 3 Antibody [NBP3-38508] - Immunofluorescence analysis of U2OS cells using Centrin 3 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry: Centrin 3 Antibody [NBP3-38508] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using Centrin 3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: Centrin 3 Antibody [NBP3-38508] - Western blot analysis of various lysates using Centrin 3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Immunohistochemistry: Centrin 3 Antibody [NBP3-38508] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Centrin 3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: Centrin 3 Antibody [NBP3-38508] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Centrin 3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Centrin 3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Centrin 3 Antibody - BSA Free (NBP3-38508) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human Centrin 3 (NP_004356.2).
  
  Sequence:
  MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CETN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:100
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 20 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Centrin 3 Antibody - BSA Free

• CDC31 yeast homolog
• CEN3centrin, EF-hand protein, 3 (CDC31 homolog, yeast)
• centrin, EF-hand protein, 3 (CDC31 yeast homolog)
• centrin, EF-hand protein, 3
• centrin-3
• EF-hand superfamily member
• MGC12502
• MGC138245

Background

Centrin 3 is encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CETN3