Centrin 3 Antibody (3E6.)

Images

 
Western Blot: Centrin 3 Antibody (3E6.) [H00001070-M01] - Centrin 3 Antibody (3E6) [H00001070-M01] - Analysis of CETN3 over-expressed 293 cell line, cotransfected with CETN3 Validated Chimera RNAi ( Cat # H00001070-R01V ...read more
Western Blot: Centrin 3 Antibody (3E6) [H00001070-M01] - Analysis of CETN3 expression in transfected 293T cell line by CETN3 monoclonal antibody (M01), clone 3E6.Lane 1: CETN3 transfected lysate(19.5 KDa).Lane 2: ...read more
Western Blot: Centrin 3 Antibody (3E6) [H00001070-M01] - CETN3 monoclonal antibody (M01), clone 3E6 Analysis of CETN3 expression in Jurkat.
ELISA: Centrin 3 Antibody (3E6.) [H00001070-M01] - Centrin 3 Antibody (3E6) [H00001070-M01] - Detection limit for recombinant GST tagged CETN3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, ZeSpecies Glossary
Applications WB, ELISA, ICC/IF, RNAi
Clone
3E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
     

Genetic Strategies

   

Order Details

Centrin 3 Antibody (3E6.) Summary

Immunogen
CETN3 (AAH05383, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPH
Specificity
CETN3 - centrin, EF-hand protein, 3 (CDC31 homolog, yeast)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CETN3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • RNA Inhibition
Application Notes
This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA. ICC/IF usage reported in scientific literature (PMID: 23644468).
Publications
Read Publications using
H00001070-M01 in the following applications:

  • 3 publications
  • IP
    1 publication
  • WB
    4 publications

Reactivity Notes

Zebrafish reactivity reported in scientific literature (PMID: 25344692).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Centrin 3 Antibody (3E6.)

  • CDC31 yeast homolog
  • CEN3centrin, EF-hand protein, 3 (CDC31 homolog, yeast)
  • centrin, EF-hand protein, 3 (CDC31 yeast homolog)
  • centrin, EF-hand protein, 3
  • centrin-3
  • EF-hand superfamily member
  • MGC12502
  • MGC138245

Background

The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14909
Species: Hu
Applications: WB, IP
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NBP1-88213
Species: Hu
Applications: IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-13382
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001070-M01
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-60949
Species: AB, Bv, Gt, Sh, WB
Applications: Flow, Func, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00008847-P01
Species: Hu
26660002
Species: Hu
Applications: ELISA, IHC, IHC-P
DDX0010P-100
Species: Hu, Ca
Applications: Flow, Func, IHC, IHC-Fr, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NLS1729
Species: Hu, Eq
Applications: WB, IHC-P
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB100-2359
Species: Hu
Applications: WB, IHC, IP

Publications for Centrin 3 Antibody (H00001070-M01)(23)

We have publications tested in 2 confirmed species: Human, Zebrafish.

We have publications tested in 3 applications: ICC/IF, IP, WB.


Filter By Application
ICC/IF
(3)
IP
(1)
WB
(4)
All Applications
Filter By Species
Human
(4)
Zebrafish
(1)
All Species
Showing Publications 1 - 10 of 23. Show All 23 Publications.
Publications using H00001070-M01 Applications Species
Wang JT, Kong D, Hoerner CR et al. Centriole triplet microtubules are required for stable centriole formation and inheritance in human cells. Elife. 2017 Sep 14 [PMID: 28906251] (ICC/IF, Human) ICC/IF Human
Doobin DJ, Kemal S, Dantas TJ, Vallee RB Severe NDE1-mediated microcephaly results from neural progenitor cell cycle arrests at multiple specific stages. Nat Commun 2016 Aug 24 [PMID: 27553190] (WB) WB
Tambe MB, Narvi E, Kallio M. Reduced levels of Dusp3/Vhr phosphatase impair normal spindle bipolarity in an Erk1/2 activity dependent manner. FEBS Letters 2016 Jul 16 [PMID: 27423135]
Chavali PL, Chandrasekaran G, Barr AR et al. A CEP215-HSET complex links centrosomes with spindle poles and drives centrosome clustering in cancer. Nat Commun 2016 Mar 18 [PMID: 26987684] (WB) WB
Sawant DB, Majumder S, Perkins JL et al. Centrin 3 is an inhibitor of centrosomal Mps1 and antagonizes Centrin 2 function. Mol. Biol. Cell 2015 Sep 09 [PMID: 26354417] (WB, IP, Human) WB, IP Human
Antonczak AK, Mullee LI, Wang Y et al. Opposing effects of pericentrin and microcephalin on the pericentriolar material regulate CHK1 activation in the DNA damage response. Oncogene. 2015 Jul 13 [PMID: 26165835]
Martin Ca, Ahmad I, Klingseisen A et al. Mutations in PLK4, encoding a master regulator of centriole biogenesis, cause microcephaly, growth failure and retinopathy. Nat. Genet. 2014 Oct 26 [PMID: 25344692] (ICC/IF, Zebrafish) ICC/IF Zebrafish
Kaczmarczyk A, Sullivan KF. CENP-W Plays a Role in Maintaining Bipolar Spindle Structure. PLoS One. 2014 Oct 15 [PMID: 25329824]
Lee Yin Loon, Sante Joshua, Comerci Colin J et al. Cby1 promotes Ahi1 recruitment to a ring-shaped domain at the centriole-cilium interface and facilitates proper cilium formation and function. Mol Biol Cell. 2014 Oct 01 [PMID: 25103236] (WB) WB
Maki-Jouppila Jenni H E, Laine Leena J, Rehnberg Jonathan et al. Centmitor-1, a novel acridinyl-acetohydrazide, possesses similar molecular interaction field and antimitotic cellular phenotype as rigosertib, on 01910.Na. Mol Cancer Ther. 2014 Apr 18 [PMID: 24748653] (Human) Human
Show All 23 Publications.

Reviews for Centrin 3 Antibody (H00001070-M01) (0)

There are no reviews for Centrin 3 Antibody (H00001070-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Centrin 3 Antibody (H00001070-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Centrin 3 Products

Bioinformatics Tool for Centrin 3 Antibody (H00001070-M01)

Discover related pathways, diseases and genes to Centrin 3 Antibody (H00001070-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Centrin 3 Antibody (H00001070-M01)

Discover more about diseases related to Centrin 3 Antibody (H00001070-M01).
 

Pathways for Centrin 3 Antibody (H00001070-M01)

View related products by pathway.

Research Areas for Centrin 3 Antibody (H00001070-M01)

Find related products by research area.

Blogs on Centrin 3

There are no specific blogs for Centrin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Centrin 3 Antibody (3E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol CETN3
Entrez
OMIM
Uniprot