Centrin 3 Antibody (3E6) - Azide and BSA Free

Western Blot: Centrin 3 Antibody (3E6) [H00001070-M01] - Analysis of 293T cells using Centrin 3 antibody (3E6). Image from verified customer review.

Western Blot: Centrin 3 Antibody (3E6) [H00001070-M01] - CETN3 monoclonal antibody (M01), clone 3E6 Analysis of CETN3 expression in Jurkat.

Western Blot: Centrin 3 Antibody (3E6) [H00001070-M01] - Analysis of CETN3 expression in transfected 293T cell line by CETN3 monoclonal antibody (M01), clone 3E6.Lane 1: CETN3 transfected lysate(19.5 KDa).Lane 2: Non-transfected lysate.

Western Blot: Centrin 3 Antibody (3E6) [H00001070-M01] - Centrin 3 Antibody (3E6) [H00001070-M01] - Analysis of CETN3 over-expressed 293 cell line, cotransfected with CETN3 Validated Chimera RNAi ( Cat # H00001070-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CETN3 monoclonal antibody (M01), clone 3E6 (Cat # H00001070-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

ELISA: Centrin 3 Antibody (3E6) [H00001070-M01] - Centrin 3 Antibody (3E6) [H00001070-M01] - Detection limit for recombinant GST tagged CETN3 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt, Ch, Ze
• Applications: WB, ELISA, ICC/IF, IP, KD
• Clone: 3E6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Centrin 3 Antibody (3E6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CETN3 (AAH05383, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPH
• Specificity: CETN3 - centrin, EF-hand protein, 3 (CDC31 homolog, yeast)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CETN3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Immunoprecipitation
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: This antibody reactivity against cell lysate and recombinant protein for WB. ICC/IF usage reported in scientific literature (PMID: 23644468). Use in Immunoprecipitation reported in scientific literature (PMID: 26354417)

Reactivity Notes

Zebrafish reactivity reported in scientific literature (PMID: 25344692).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Centrin 3 Antibody (3E6) - Azide and BSA Free

• CDC31 yeast homolog
• CEN3centrin, EF-hand protein, 3 (CDC31 homolog, yeast)
• centrin, EF-hand protein, 3 (CDC31 yeast homolog)
• centrin, EF-hand protein, 3
• centrin-3
• EF-hand superfamily member
• MGC12502
• MGC138245

Background

The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Centrin 3 Antibody (H00001070-M01)(47)

Publications using H00001070-M01

• Tsekitsidou E, Wong CJ, Ulengin-Talkish I et al. Calcineurin associates with centrosomes and regulates cilia length maintenance Journal of Cell Science 2023-04-15 [PMID: 37013443]
• Ke N, Ziming L, Tia K et al. Characterization of Primary Cilia Formation in Human ESC-Derived Retinal Organoids. Stem Cells Int. 2023-01-13 [PMID: 36684387]
• L�pez-Jim�nez P, P�rez-Mart�n S, Hidalgo I et al. The Male Mouse Meiotic Cilium Emanates from the Mother Centriole at Zygotene Prior to Centrosome Duplication Cells 2022-12-29 [PMID: 36611937]
• Marine L, Imene B, Eloise B et al. Human SFI1 and Centrin form a complex critical for centriole architecture and ciliogenesis. EMBO J. 2022-09-20 [PMID: 36125182]
• Carlos S, Helu L, Jun Q et al. Prominin 1 and Notch regulate ciliary length and dynamics in multiciliated cells of the airway epithelium. iScience. 2022-07-14 [PMID: 35942101]
• I B, LOpez-JimEnez P, Mena I et al. Haspin participates in AURKB recruitment to centromeres and contributes to chromosome congression in male mouse meiosis Journal of cell science 2022-06-13 [PMID: 35694956]
• T Tischer, J Yang, D Barford The APC/C targets the Cep152-Cep63 complex at the centrosome to regulate mitotic spindle assembly Journal of Cell Science, 2022-01-18;0(0):. 2022-01-18 [PMID: 34878135]
• Mengdie W, Gregory R, Anne C et al. Immunofluorescence-based Determination of Centrosome Number in Tissue Samples. Bio Protoc. 2019-10-20 [PMID: 33654897]
• Sala R, Farrell KC, Stearns T Growth disadvantage associated with centrosome amplification drives population-level centriole number homeostasis Mol. Biol. Cell 2020-09-23 [PMID: 32966175] (ICC/IF, Human)
• Wigington CP, Roy J, Damle NP et al. Systematic Discovery of Short Linear Motifs Decodes Calcineurin Phosphatase Signaling Mol. Cell 2020-07-16 [PMID: 32645368]
• Ozge A, Sevket T, Can G et al. Acute inhibition of centriolar satellite function and positioning reveals their functions at the primary cilium. PLoS Biol. 2020-06-18 [PMID: 32555591]
• H G, Efraim C, Melis A et al. CCDC57 Cooperates with Microtubules and Microcephaly Protein CEP63 and Regulates Centriole Duplication and Mitotic Progression. Cell Rep. 2020-05-12 [PMID: 32402286]
• Takashi O, Valentina Q, Huawen L et al. CCDC61/VFL3 Is a Paralog of SAS6 and Promotes Ciliary Functions. Structure. 2020-05-05 [PMID: 32375023]
• Wang T, Zou Y, Huang N et al. CCDC84 Acetylation Oscillation Regulates Centrosome Duplication by Modulating HsSAS-6 Degradation. Cell Rep. 2019-11-12 [PMID: 31722219]
• Bassaganyas L, Popa SJ, Horlbeck M et al. New factors for protein transport identified by a genome-wide CRISPRi screen in mammalian cells J. Cell Biol. 2019-11-04 [PMID: 31488582] (ICC/IF, Human)
• Wang M, Nagle R, Knudsen B et al. Centrosome loss results in an unstable genome and malignant prostate tumors. Oncogene. 2019-09-02 [PMID: 31477840]
• Mariappan A, Soni K, Schorpp K et al. Inhibition of CPAP-tubulin interaction prevents proliferation of centrosome-amplified cancer cells EMBO J. 2018-12-10 [PMID: 30530478] (ICC/IF, Human)
• Jenks AD, Vyse S, Wong JP et al. Primary Cilia Mediate Diverse Kinase Inhibitor Resistance Mechanisms in Cancer. Cell Rep 2018-06-05 [PMID: 29874589]
• Krastev DB, Pettitt SJ, Campbell J et al. Coupling bimolecular PARylation biosensors with genetic screens to identify PARylation targets. Nat Commun 2018-05-22 [PMID: 29789535]
• David K. Breslow, Sascha Hoogendoorn, Adam R. Kopp, David W. Morgens, Brandon K. Vu, Margaret C. Kennedy, Kyuho Han, Amy Li, Gaelen T. Hess, Michael C. Bassik, James K. Chen, Maxence V. Nachury A CRISPR-based screen for Hedgehog signaling provides insights into ciliary function and ciliopathies Nature genetics 2017-12-27 [PMID: 29459677]
• Ogungbenro YA, Tena TC, Gaboriau D et al. Centrobin controls primary ciliogenesis in vertebrates. J Cell Biol 2018-02-13 [PMID: 29440264]
• Wang JT, Kong D, Hoerner CR et al. Centriole triplet microtubules are required for stable centriole formation and inheritance in human cells. Elife. 2017-09-14 [PMID: 28906251] (ICC/IF, Human)
• Chen HY, Wu CT, Tang CC et al. Human microcephaly protein RTTN interacts with STIL and is required to build full-length centrioles Nat Commun 2017-08-15 [PMID: 28811500]
• Pruikkonen S, Kallio MJ. Excess of a Rassf1-targeting microRNA, miR-193a-3p, perturbs cell division fidelity. Br J Cancer 2017-04-27 [PMID: 28449010]
• Doobin DJ, Kemal S, Dantas TJ, Vallee RB Severe NDE1-mediated microcephaly results from neural progenitor cell cycle arrests at multiple specific stages. Nat Commun 2016-08-24 [PMID: 27553190] (WB)
• Tambe MB, Narvi E, Kallio M. Reduced levels of Dusp3/Vhr phosphatase impair normal spindle bipolarity in an Erk1/2 activity dependent manner. FEBS Letters 2016-07-16 [PMID: 27423135]
• Chang CW, Hsu WB, Tsai JJ et al. CEP295 interacts with microtubules and is required for centriole elongation. J. Cell. Sci. 2016-05-16 [PMID: 27185865]
• Chavali PL, Chandrasekaran G, Barr AR et al. A CEP215-HSET complex links centrosomes with spindle poles and drives centrosome clustering in cancer. Nat Commun 2016-03-18 [PMID: 26987684] (WB)
• Sawant DB, Majumder S, Perkins JL et al. Centrin 3 is an inhibitor of centrosomal Mps1 and antagonizes Centrin 2 function. Mol. Biol. Cell 2015-09-09 [PMID: 26354417] (WB, IP, Human)
• Antonczak AK, Mullee LI, Wang Y et al. Opposing effects of pericentrin and microcephalin on the pericentriolar material regulate CHK1 activation in the DNA damage response. Oncogene. 2015-07-13 [PMID: 26165835]
• Martin Ca, Ahmad I, Klingseisen A et al. Mutations in PLK4, encoding a master regulator of centriole biogenesis, cause microcephaly, growth failure and retinopathy. Nat. Genet. 2014-10-26 [PMID: 25344692] (ICC/IF, Zebrafish)
• Kaczmarczyk A, Sullivan KF. CENP-W Plays a Role in Maintaining Bipolar Spindle Structure. PLoS One. 2014-10-15 [PMID: 25329824]
• Lee Yin Loon, Sante Joshua, Comerci Colin J et al. Cby1 promotes Ahi1 recruitment to a ring-shaped domain at the centriole-cilium interface and facilitates proper cilium formation and function. Mol Biol Cell. 2014-10-01 [PMID: 25103236] (WB)
• Maki-Jouppila Jenni H E, Laine Leena J, Rehnberg Jonathan et al. Centmitor-1, a novel acridinyl-acetohydrazide, possesses similar molecular interaction field and antimitotic cellular phenotype as rigosertib, on 01910.Na. Mol Cancer Ther. 2014-04-18 [PMID: 24748653] (Human)
• Sir JH, Putz M, Daly O et al. Loss of centrioles causes chromosomal instability in vertebrate somatic cells. J Cell Biol. 2013-12-02 [PMID: 24297747]
• Inanc B, Puetz M, Lalor P et al. Abnormal centrosomal structure and duplication in Cep135-deficient vertebrate cells. Mol Biol Cell. 2013-07-17 [PMID: 23864714]
• Dantas TJ, Daly OM, Conroy PC et al. Calcium-Binding Capacity of Centrin2 Is Required for Linear POC5 Assembly but Not for Nucleotide Excision Repair. PLoS One. 2013-07-02 [PMID: 23844208]
• Patel K, Scrimieri F, Ghosh S et al. FAM190A Deficiency Creates a Cell Division Defect. Am J Pathol. 2013-05-09 [PMID: 23665203]
• Wang WJ, Tay HG, Soni R et al. CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base. Nat Cell Biol 2013-06-01 [PMID: 23644468] (ICC/IF, Human)
• Schaub JR, Stearns T. The Rilp-like proteins Rilpl1 and Rilpl2 regulate ciliary membrane content. Mol Biol Cell. 2012-12-21 [PMID: 23264467]
• McIntyre RE, Lakshminarasimhan Chavali P, Ismail O et al. Disruption of mouse cenpj, a regulator of centriole biogenesis, phenocopies seckel syndrome. PLoS Genet. 2012-11-15 [PMID: 23166506]
• Conroy PC, Saladino C, Dantas TJ et al. C-NAP1 and rootletin restrain DNA damage-induced centriole splitting and facilitate ciliogenesis. Cell Cycle. 2012-10-15 [PMID: 23070519]
• Loffler H, Fechter A, Liu FY et al. DNA damage-induced centrosome amplification occurs via excessive formation of centriolar satellites. Oncogene. 2012-07-23 [PMID: 22824794]
• Sir JH, Barr AR, Nicholas AK et al. A primary microcephaly protein complex forms a ring around parental centrioles. Nat Genet. 2011-10-09 [PMID: 21983783]
• Dantas TJ, Wang Y, Lalor P et al. Defective nucleotide excision repair with normal centrosome structures and functions in the absence of all vertebrate centrins. J Cell Biol. 2011-04-11 [PMID: 21482720]
• Fabian Z, Fearnhead HO. arrest in prometaphase. Biochem Biophys Res Commun;395(4):458-64. 2010-05-14 [PMID: 20381455]
• Barr AR, Kilmartin JV, Gergely F et al. CDK5RAP2 functions in centrosome to spindle pole attachment and DNA damage response. J Cell Biol 2010-04-01 [PMID: 20368616]

Review for Centrin 3 Antibody (H00001070-M01) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 02/07/2022

Summary

• Application: Western Blot
• Sample Tested: 293T cell line
• Species: Human
• Lot: 3E6

Bioinformatics

• Gene Symbol: CETN3
• Entrez:
  • 1070(Human)
• OMIM:
  • 602907(Human)
• Uniprot:
  • AAH05383(Human)