Centrin 2 Antibody (3F8)

Images

 
Sandwich ELISA: Centrin 2 Antibody (3F8) [H00001069-M01] - Detection limit for recombinant GST tagged CETN2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Centrin 2 Antibody (3F8) Summary

Immunogen
CETN2 (NP_004335 85 a.a. - 172 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Specificity
CETN2 - centrin, EF-hand protein, 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CETN2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00001069-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Centrin 2 Antibody (3F8)

  • Caltractin isoform 1
  • CEN2CALTcaltractin (20kD calcium-binding protein)
  • centrin, EF-hand protein, 2
  • centrin-2

Background

Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88213
Species: Hu
Applications: IHC, IHC-P
NBP2-14909
Species: Hu
Applications: WB, IP
NBP2-45514
Species: Hu
Applications: WB, IHC
H00001070-M01
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, RNAi
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
21310002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-39059
Species: Hu
Applications: IHC, IHC-P
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-13249
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Centrin 2 Antibody (H00001069-M01)(1)

Reviews for Centrin 2 Antibody (H00001069-M01) (0)

There are no reviews for Centrin 2 Antibody (H00001069-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Centrin 2 Antibody (H00001069-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Centrin 2 Products

Bioinformatics Tool for Centrin 2 Antibody (H00001069-M01)

Discover related pathways, diseases and genes to Centrin 2 Antibody (H00001069-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Centrin 2 Antibody (H00001069-M01)

Discover more about diseases related to Centrin 2 Antibody (H00001069-M01).
 

Pathways for Centrin 2 Antibody (H00001069-M01)

View related products by pathway.

PTMs for Centrin 2 Antibody (H00001069-M01)

Learn more about PTMs related to Centrin 2 Antibody (H00001069-M01).
 

Research Areas for Centrin 2 Antibody (H00001069-M01)

Find related products by research area.

Blogs on Centrin 2

There are no specific blogs for Centrin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Centrin 2 Antibody (3F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CETN2
Entrez
OMIM
Uniprot