Centrin 2 Antibody (3F8) - Azide and BSA Free

Sandwich ELISA: Centrin 2 Antibody (3F8) [H00001069-M01] - Detection limit for recombinant GST tagged CETN2 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Ch
• Applications: WB, ELISA, ICC/IF
• Clone: 3F8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Centrin 2 Antibody (3F8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CETN2 (NP_004335, 85 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
• Specificity: CETN2 - centrin, EF-hand protein, 2
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CETN2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Centrin 2 Antibody (3F8) - Azide and BSA Free

• Caltractin isoform 1
• CEN2CALTcaltractin (20kD calcium-binding protein)
• centrin, EF-hand protein, 2
• centrin-2

Background

Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Centrin 2 Antibody (H00001069-M01)(1)

Publication using H00001069-M01

• Barr AR, Kilmartin JV, Gergely F et al. CDK5RAP2 functions in centrosome to spindle pole attachment and DNA damage response. J Cell Biol 2010-04-01 [PMID: 20368616]

Bioinformatics

• Gene Symbol: CETN2
• Entrez:
  • 1069(Human)
• OMIM:
  • 300006(Human)
• Uniprot:
  • NP_004335(Human)