Centaurin alpha 2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human Centaurin alpha 2. Peptide sequence: IRAKYERREFMADGETISLPGNREGFLWKRGRDNSQFLRRKFVLLAREGL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADAP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Centaurin alpha 2 Antibody - BSA Free
Background
Centaurin alpha 2 is a potential GTPase-activating protein for the ADP ribosylation factor family. It binds phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosphate (InsP4). It possesses a stoichiometry of two binding sites for InsP4 with identical affinity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA, Flow, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: WB
Publications for Centaurin alpha 2 Antibody (NBP2-86599) (0)
There are no publications for Centaurin alpha 2 Antibody (NBP2-86599).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Centaurin alpha 2 Antibody (NBP2-86599) (0)
There are no reviews for Centaurin alpha 2 Antibody (NBP2-86599).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Centaurin alpha 2 Antibody (NBP2-86599) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Centaurin alpha 2 Products
Research Areas for Centaurin alpha 2 Antibody (NBP2-86599)
Find related products by research area.
|
Blogs on Centaurin alpha 2