CENPV Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse CENPV Antibody - Azide and BSA Free (H00201161-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
PRR6 (AAH52604, 1 a.a. - 275 a.a.) full-length human protein. MRRSRSSAAAKLRGQKRSGASGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPPSEKPRLRRSSPRAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWETFQKRQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQNRHFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSMVTEEFNGSDWEKAMKEHKTIKNMSKE |
| Specificity |
Reacts with proline rich 6. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
CENPV |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
| Application Notes |
This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CENPV Antibody - Azide and BSA Free
Background
CENPV is required for distribution of pericentromeric heterochromatin in interphase nuclei and for centromereformation and organization, chromosome alignment and cytokinesis
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Publications for CENPV Antibody (H00201161-B01P) (0)
There are no publications for CENPV Antibody (H00201161-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CENPV Antibody (H00201161-B01P) (0)
There are no reviews for CENPV Antibody (H00201161-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CENPV Antibody (H00201161-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CENPV Products
Blogs on CENPV