CENPN Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CENPN Antibody [NBP2-55538] - Staining of human cell line HeLa shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CENPN Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQKVWEV
Specificity
Specificity of human CENPN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CENPN
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CENPN Antibody

  • BM039
  • C16orf60
  • CENP-N
  • centromere protein N
  • chromosome 16 open reading frame 60
  • FLJ13607
  • FLJ22660
  • ICEN32
  • Interphase centromere complex protein 32

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52937
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00064105-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-76240
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00002491-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-88485
Species: Hu
Applications: WB, IHC, IHC-P
H00378708-P01
Species: Hu
NBP1-85688
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55216
Species: Hu
Applications: WB
NBP2-34079
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89223
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ChIP
NBP1-54899
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-85687
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-338
Species: Hu, Ha
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP, PLA
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-55538
Species: Hu
Applications: ICC/IF

Publications for CENPN Antibody (NBP2-55538) (0)

There are no publications for CENPN Antibody (NBP2-55538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPN Antibody (NBP2-55538) (0)

There are no reviews for CENPN Antibody (NBP2-55538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CENPN Antibody (NBP2-55538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CENPN Products

Bioinformatics Tool for CENPN Antibody (NBP2-55538)

Discover related pathways, diseases and genes to CENPN Antibody (NBP2-55538). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for CENPN Antibody (NBP2-55538)

Find related products by research area.

Blogs on CENPN

There are no specific blogs for CENPN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENPN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPN