CENPL Antibody

Images

 
Western Blot: CENPL Antibody [NBP1-88485] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: CENPL Antibody [NBP1-88485] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CENPL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MDSYSAPESTPSASSRPEDYFIGATPLQKRLESVRKQSSFILTPPRRKIPQCSQLQEDVDPQKVAFLLHKQWTLYSLTPLYKF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CENPL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CENPL Protein (NBP1-88485PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CENPL Antibody

  • C1orf155
  • CENP-L
  • centromere protein L
  • chromosome 1 open reading frame 155
  • dJ383J4.3
  • FLJ31044
  • FLJ31786
  • ICEN33
  • Interphase centromere complex protein 33
  • RP3-383J4.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP1-76240
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-79664
Species: Hu
Applications: WB, ICC/IF
H00064105-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85688
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-55216
Species: Hu
Applications: WB
NBP2-55474
Species: Hu
Applications: ICC/IF
H00378708-B01P
Species: Hu
Applications: WB, ELISA
H00079019-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-2586
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
H00002491-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-85687
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IP
NBP1-55505
Species: Hu
Applications: WB
NB120-3458
Species: Hu, Mu, Rt
Applications: WB

Publications for CENPL Antibody (NBP1-88485) (0)

There are no publications for CENPL Antibody (NBP1-88485).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPL Antibody (NBP1-88485) (0)

There are no reviews for CENPL Antibody (NBP1-88485). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CENPL Antibody (NBP1-88485) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CENPL Products

Bioinformatics Tool for CENPL Antibody (NBP1-88485)

Discover related pathways, diseases and genes to CENPL Antibody (NBP1-88485). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CENPL Antibody (NBP1-88485)

Discover more about diseases related to CENPL Antibody (NBP1-88485).

Blogs on CENPL

There are no specific blogs for CENPL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENPL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPL