![Western Blot: CENPL Antibody [NBP1-88485] - Analysis in control (vector only transfected HEK293T lysate) and CENPL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/CENPL-Antibody-Western-Blot-NBP1-88485-img0004.jpg "Western Blot: CENPL Antibody [NBP1-88485] - Analysis in control (vector only transfected HEK293T lysate) and CENPL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MDSYSAPESTPSASSRPEDYFIGATPLQKRLESVRKQSSFILTPPRRKIPQCSQLQEDVDPQKVAFLLHKQWTLYSLTPLYKF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CENPL |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunocytochemistry-Immunofluorescence-H00064105-M01-img0005.jpg)
-Western-Blot-H00064105-M01-img0007.jpg)
-Sandwich-ELISA-H00064105-M01-img0006.jpg)
-Immunocytochemistry-Immunofluorescence-NB100-338-img0017.jpg)
-Immunocytochemistry-Immunofluorescence-NB100-338-img0003.jpg)
-Immunocytochemistry-Immunofluorescence-NB100-338-img0001.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for CENPL Antibody (NBP1-88485)Discover more about diseases related to CENPL Antibody (NBP1-88485).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CENPL |
![Immunohistochemistry-Paraffin: CENPL Antibody [NBP1-88485] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/CENPL-Antibody-Immunohistochemistry-Paraffin-NBP1-88485-img0002.jpg "Immunohistochemistry-Paraffin: CENPL Antibody [NBP1-88485] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")