CENPJ Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CENPJ Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CENPJ
  
  

  Source: E.coli

  Amino Acid Sequence: SNILSHEQSNFCRTAHGDFVLTSKRASPNLFSEAQYQEAPVEKNNLKEENRNHPTGESILCWEKVTEQIQEANDKNLQKHDDSSEVANIEERPIKAAIG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CPEP
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24733It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CENPJ Recombinant Protein Antigen

• BM032
• CENP-J
• centromere protein J
• Centrosomal P4.1-associated protein
• CPAPMCPH6
• LAG-3-associated protein
• LAPSCKL4
• LIP1microcephaly, primary autosomal recessive 6
• LYST-interacting protein 1
• LYST-interacting protein LIP1
• LYST-interacting protein LIP7
• MGC131581
• MGC131582
• MGC142222
• MGC142224
• Sas-4
• SASS4

Background

CENPJ encodes a protein that belongs to the centromere protein family. During cell division, this protein plays a structural role in the maintenance of centrosome integrity and normal spindle morphology, and it is involved in microtubule disassembly at the centrosome. This protein can function as a transcriptional coactivator in the Stat5 signaling pathway, and also as a coactivator of NF-kappaB-mediated transcription, likely via its interaction with the coactivator p300/CREB-binding protein. Mutations in this gene are associated with primary autosomal recessive microcephaly, a disorder characterized by severely reduced brain size and mental retardation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CPEP