CENPJ Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CENPJ Source: E.coli
Amino Acid Sequence: SNILSHEQSNFCRTAHGDFVLTSKRASPNLFSEAQYQEAPVEKNNLKEENRNHPTGESILCWEKVTEQIQEANDKNLQKHDDSSEVANIEERPIKAAIG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CPAP |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24733It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for CENPJ Recombinant Protein Antigen
Background
CENPJ encodes a protein that belongs to the centromere protein family. During cell division, this protein plays a structural role in the maintenance of centrosome integrity and normal spindle morphology, and it is involved in microtubule disassembly at the centrosome. This protein can function as a transcriptional coactivator in the Stat5 signaling pathway, and also as a coactivator of NF-kappaB-mediated transcription, likely via its interaction with the coactivator p300/CREB-binding protein. Mutations in this gene are associated with primary autosomal recessive microcephaly, a disorder characterized by severely reduced brain size and mental retardation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: IHC, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Publications for CENPJ Recombinant Protein Antigen (NBP3-24733PEP) (0)
There are no publications for CENPJ Recombinant Protein Antigen (NBP3-24733PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CENPJ Recombinant Protein Antigen (NBP3-24733PEP) (0)
There are no reviews for CENPJ Recombinant Protein Antigen (NBP3-24733PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for CENPJ Recombinant Protein Antigen (NBP3-24733PEP) (0)
Additional CENPJ Products
Research Areas for CENPJ Recombinant Protein Antigen (NBP3-24733PEP)
Find related products by research area.
|
Blogs on CENPJ