CENPC Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CENPC Antibody [NBP2-55474] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies, cytokinetic bridge, midbody, midbody ring & cleavage furrow.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CENPC Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSGKNDVDDEEVHGSSDDSKQSKVIPKNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGERIDYQGRPSGGFVISGVLSPDTISSKRK
Specificity
Specificity of human CENPC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CENPC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CENPC Recombinant Protein Antigen (NBP2-55474PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CENPC Antibody

  • CENP-C 1
  • CENP-C
  • CENPCInterphase centromere complex protein 7
  • Centromere autoantigen C
  • centromere autoantigen C1
  • centromere protein C 1
  • hcp-4
  • ICEN7
  • MIF2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB100-2369
Species: Hu
Applications: ICC/IF, IHC
NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2359
Species: Hu
Applications: WB, IHC, IP
NB100-338
Species: Hu, Rt, Ha
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
H00002491-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
NB100-56444
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
H00378708-P01
Species: Hu
NB100-563
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-34093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-67842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4185
Species: Hu
Applications: ICC
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready

Publications for CENPC Antibody (NBP2-55474) (0)

There are no publications for CENPC Antibody (NBP2-55474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPC Antibody (NBP2-55474) (0)

There are no reviews for CENPC Antibody (NBP2-55474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CENPC Antibody (NBP2-55474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CENPC Antibody (NBP2-55474)

Discover related pathways, diseases and genes to CENPC Antibody (NBP2-55474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CENPC Antibody (NBP2-55474)

Discover more about diseases related to CENPC Antibody (NBP2-55474).
 

Pathways for CENPC Antibody (NBP2-55474)

View related products by pathway.

PTMs for CENPC Antibody (NBP2-55474)

Learn more about PTMs related to CENPC Antibody (NBP2-55474).

Blogs on CENPC

There are no specific blogs for CENPC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENPC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPC1