CENPA Antibody

Images

 
Western Blot: CENPA Antibody [NBP2-92632] - Analysis of extracts of various cell lines, using CENPA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: ...read more
Immunocytochemistry/ Immunofluorescence: CENPA Antibody [NBP2-92632] - Analysis of U-2 OS cells using CENPA . Blue: DAPI for nuclear staining.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CENPA Antibody Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CENPA (NP_001800.1). MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CENPA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1:50-1:100
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.05% Proclin 300
Purity
Affinity purified

Alternate Names for CENPA Antibody

  • Centromere autoantigen A
  • centromere protein A (17kD)
  • centromere protein ACENP-Acentromere protein A, 17kDa
  • histone H3-like centromeric protein A

Background

Centromere protein A (CENP-A) is a 17 kD centromere-specific histone variant with 62% amino acids homology to the C-terminal of histone H3. Localized in the centromere, it plays a central role in the centromere-specific chromatin formation. The depletion of histone H3 at the CENP-A binding domain suggests CENP-A to be a possible replacement for histone H3 in the packaging process of

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001059-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-82546
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002491-B01P
Species: Hu
Applications: ICC/IF, WB
NB100-338
Species: Ha, Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, PLA, WB
NBP2-46617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2359
Species: Hu
Applications: IHC, IP, WB
NBP1-85025
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56346
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
H00008337-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-37471
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00378708-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-92632
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for CENPA Antibody (NBP2-92632) (0)

There are no publications for CENPA Antibody (NBP2-92632).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPA Antibody (NBP2-92632) (0)

There are no reviews for CENPA Antibody (NBP2-92632). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CENPA Antibody (NBP2-92632) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CENPA Products

Bioinformatics Tool for CENPA Antibody (NBP2-92632)

Discover related pathways, diseases and genes to CENPA Antibody (NBP2-92632). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CENPA Antibody (NBP2-92632)

Discover more about diseases related to CENPA Antibody (NBP2-92632).
 

Pathways for CENPA Antibody (NBP2-92632)

View related products by pathway.

PTMs for CENPA Antibody (NBP2-92632)

Learn more about PTMs related to CENPA Antibody (NBP2-92632).
 

Research Areas for CENPA Antibody (NBP2-92632)

Find related products by research area.

Blogs on CENPA

There are no specific blogs for CENPA, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENPA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPA