CEBP gamma Antibody - BSA Free

Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742] - Staining in human small intestine and pancreas tissues using anti-CEBPG antibody. Corresponding CEBPG RNA-seq data are presented for the same tissues.

Western Blot: CEBP gamma Antibody [NBP1-89742] - Analysis in control (vector only transfected HEK293T lysate) and CEBPG over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: CEBP gamma Antibody [NBP1-89742] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742] - Staining of human small intestine shows high expression.

Analysis in control (vector only transfected HEK293T lysate) and CEBPG over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

ChIP-Exo-Seq composite graph for Anti-CEBPG (NBP1-89742) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CEBP gamma Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENT
• Predicted Species: Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CEBPG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CEBP gamma Protein (NBP1-89742PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CEBP gamma Antibody - BSA Free

• c/EBP gamma
• CCAAT/enhancer binding protein (C/EBP), gamma
• CCAAT/enhancer-binding protein gamma
• GPE1BP
• IG/EBP-1

Background

The transcription factor C/EBP alpha (CCAAT-enhancer binding protein) is a heatstable, sequence-specific DNA-binding protein first purified from rat liver nuclei that binds avidly to several different cis-regulatory DNA sequences commonly associated with viral and cellular genes transcribed by RNA polymerase II. C/EBP alpha regulates gene expression in a variety of tissues including liver, adipose, lung and intestine. C/EBP alpha uses a bipartite structural motif to bind DNA. Two protein chains dimerize through a set of amphipathic alpha helices termed the leucine zipper. Highly basic polypeptide regions emerge from the zipper to form a linked set of DNA contact surfaces. C/EBP alpha appears to function exclusively in terminally differentiated, growth-arrested cells. Additional family members include C/EBP beta, C/EBP gamma,C/EBP delta and C/EBP episilon, all of which exhibit similar DNA-binding specificities and affinities to C/EBP alpha. Furthermore, C/EBP beta and C/EBP delta readily form heterodimers both with each other as well as with C/EBP alpha.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CEBPG