CEBP gamma Antibody

Images

 
Western Blot: CEBP gamma Antibody [NBP1-89742] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: CEBP gamma Antibody [NBP1-89742] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742] - Staining of human cerebellum shows strong nuclear positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEBP gamma Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEBPG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CEBP gamma Protein (NBP1-89742PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEBP gamma Antibody

  • c/EBP gamma
  • CCAAT/enhancer binding protein (C/EBP), gamma
  • CCAAT/enhancer-binding protein gamma
  • GPE1BP
  • IG/EBP-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP
NBP1-89435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60930
Species: Hu, Mu
Applications: WB
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-89742
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CEBP gamma Antibody (NBP1-89742) (0)

There are no publications for CEBP gamma Antibody (NBP1-89742).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEBP gamma Antibody (NBP1-89742) (0)

There are no reviews for CEBP gamma Antibody (NBP1-89742). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CEBP gamma Antibody (NBP1-89742) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEBP gamma Products

Bioinformatics Tool for CEBP gamma Antibody (NBP1-89742)

Discover related pathways, diseases and genes to CEBP gamma Antibody (NBP1-89742). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEBP gamma Antibody (NBP1-89742)

Discover more about diseases related to CEBP gamma Antibody (NBP1-89742).
 

Pathways for CEBP gamma Antibody (NBP1-89742)

View related products by pathway.

PTMs for CEBP gamma Antibody (NBP1-89742)

Learn more about PTMs related to CEBP gamma Antibody (NBP1-89742).

Blogs on CEBP gamma.

Transcription Factor Antibodies Used In Landmark Evolutionary Study
We at Novus Biologicals offer a full antibody database targeted to transcription factor research. Recently, CEBP antibodieswere used in a research study exploring the evolution of gene regulation in various vertebrates. The results revealed surprising...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEBP gamma Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEBPG