CEBP epsilon Recombinant Protein Antigen

Images

 
There are currently no images for CEBP epsilon Protein (NBP1-85446PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CEBP epsilon Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CEBPE.

Source: E. coli

Amino Acid Sequence: SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CEBPE
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85446.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CEBP epsilon Recombinant Protein Antigen

  • C/EBP-epsilon
  • CCAAT/enhancer binding protein (C/EBP), epsilon
  • CCAAT/enhancer-binding protein epsilon
  • CEBP epsilon
  • CEBPE
  • CRP1C/EBP epsilon

Background

EBP1 (ErbB-3-binding protein 1), also known as PA2G4 (proliferation-associated 2G4), p38-2G4 or HG4-1, is a member of the peptidase M24C family and functions as an RNA-binding protein involved in cellular proliferation and differentiation processes. It is expressed in a variety of cell lines, including a wide range of tumor cell lines, and localizes to the cytoplasm. Upon treatment with Neuregulin-1 (heregulin), EBP1 translocates to the nucleus. EBP1 is a component of pre-ribosomal ribonucleoprotein complexes, participating in ribosome assembly and regulating the later steps of rRNA processing. In addition, EBP1 interacts with ErbB-3 and may function as a modulator of the ErbB-3-mediated signal transduction pathway by regulating the effects of Neuregulin-1. EBP1 also associates with histone deacetylases (HDACs), functioning as a transcriptional corepressor of cell cycle regulatory genes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-46179
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB100-77341
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB110-85519
Species: Mu
Applications: ELISA, IHC, IP, KD, KO, WB
NBP2-16012
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
H00152503-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85699
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-32974
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-84793
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP1-88762
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-75738
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-85446PEP
Species: Hu
Applications: AC

Publications for CEBP epsilon Protein (NBP1-85446PEP) (0)

There are no publications for CEBP epsilon Protein (NBP1-85446PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEBP epsilon Protein (NBP1-85446PEP) (0)

There are no reviews for CEBP epsilon Protein (NBP1-85446PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CEBP epsilon Protein (NBP1-85446PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CEBP epsilon Products

Blogs on CEBP epsilon

There are no specific blogs for CEBP epsilon, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CEBP epsilon Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CEBPE