CEBP epsilon Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CEBP epsilon Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CEBPE.
  
  

  Source: E. coli

  Amino Acid Sequence: SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPR

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CEBPE
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85446.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CEBP epsilon Recombinant Protein Antigen

• C/EBP-epsilon
• CCAAT/enhancer binding protein (C/EBP), epsilon
• CCAAT/enhancer-binding protein epsilon
• CEBP epsilon
• CEBPE
• CRP1C/EBP epsilon

Background

EBP1 (ErbB-3-binding protein 1), also known as PA2G4 (proliferation-associated 2G4), p38-2G4 or HG4-1, is a member of the peptidase M24C family and functions as an RNA-binding protein involved in cellular proliferation and differentiation processes. It is expressed in a variety of cell lines, including a wide range of tumor cell lines, and localizes to the cytoplasm. Upon treatment with Neuregulin-1 (heregulin), EBP1 translocates to the nucleus. EBP1 is a component of pre-ribosomal ribonucleoprotein complexes, participating in ribosome assembly and regulating the later steps of rRNA processing. In addition, EBP1 interacts with ErbB-3 and may function as a modulator of the ErbB-3-mediated signal transduction pathway by regulating the effects of Neuregulin-1. EBP1 also associates with histone deacetylases (HDACs), functioning as a transcriptional corepressor of cell cycle regulatory genes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CEBPE