CEBP Delta Recombinant Protein Antigen

Images

 
There are currently no images for CEBP Delta Recombinant Protein Antigen (NBP2-56564PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CEBP Delta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CEBP Delta.

Source: E. coli

Amino Acid Sequence: AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CEBPD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56564.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CEBP Delta Recombinant Protein Antigen

  • C/EBP-delta
  • CCAAT/enhancer binding protein (C/EBP), delta
  • CCAAT/enhancer-binding protein delta
  • CELF
  • CRP3
  • NF-IL6-betaC/EBP delta
  • Nuclear factor NF-IL6-beta

Background

C/EBP proteins are DNA-binding proteins that are important transcriptional activators in the regulation of genes involved in immune and inflammatory responses and may play an important role in the regulation of the several genes associated with activation and/or differentiation of macrophages. Members of the C/EBP transcription factor family are related by a high degree of amino acid sequence identity to the basic leucine zipper DNA-binding domain and show distinct but overlapping patterns of tissue- and stage-restricted expression. Osada et al. identified the consensus binding site for the family as RTTGCGYAAY (R = A or G, and Y = C or T). Phosphorylation of C/EBP delta may increase binding activity, whereas phosphorylation of the alpha and beta family members may decrease binding affinity. C/EBP delta is a nuclear protein that binds DNA as a dimer and can form stable heterodimers with all other C/EBP family members.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46179
Species: Hu
Applications: IHC,  IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
H00152503-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85699
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB200-316
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: Flow, GS, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF7094
Species: Hu
Applications: IHC
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP3-13841
Species: Hu
Applications: Flow, ICC/IF, PA
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-85446
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-55165
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-56564PEP
Species: Hu
Applications: AC

Publications for CEBP Delta Recombinant Protein Antigen (NBP2-56564PEP) (0)

There are no publications for CEBP Delta Recombinant Protein Antigen (NBP2-56564PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEBP Delta Recombinant Protein Antigen (NBP2-56564PEP) (0)

There are no reviews for CEBP Delta Recombinant Protein Antigen (NBP2-56564PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CEBP Delta Recombinant Protein Antigen (NBP2-56564PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CEBP Delta Products

Research Areas for CEBP Delta Recombinant Protein Antigen (NBP2-56564PEP)

Find related products by research area.

Blogs on CEBP Delta

There are no specific blogs for CEBP Delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CEBP Delta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CEBPD