CEACAM1/CD66a Antibody

Images

 
Western Blot: CEACAM3 Antibody [NBP1-85743] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: CEACAM3 Antibody [NBP1-85743] - Staining of human duodenum shows strong cytoplasmic positivity in a subset of leukocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEACAM1/CD66a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEACAM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CEACAM1/CD66a Recombinant Protein Antigen (NBP1-85743PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEACAM1/CD66a Antibody

  • antigen CD66
  • BGP1
  • BGP-1
  • BGP1BGPBiliary glycoprotein 1
  • BGPI
  • Biliary Glycoprotein 1
  • biliary glycoprotein adhesion molecule
  • carcinoembryonic antigen-related cell adhesion molecule 1 (biliaryglycoprotein)
  • carcinoembryonic antigen-related cell adhesion molecule 1
  • CD66a antigen
  • CD66a
  • Cea-1
  • CEACAM1
  • CEACAM-1
  • Hv-1
  • Hv-2
  • MHVR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6146
Species: Hu
Applications: ICC
NBP2-35213
Species: Hu
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
MAB3934
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85743
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CEACAM1/CD66a Antibody (NBP1-85743) (0)

There are no publications for CEACAM1/CD66a Antibody (NBP1-85743).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEACAM1/CD66a Antibody (NBP1-85743) (0)

There are no reviews for CEACAM1/CD66a Antibody (NBP1-85743). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CEACAM1/CD66a Antibody (NBP1-85743) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEACAM1/CD66a Products

Bioinformatics Tool for CEACAM1/CD66a Antibody (NBP1-85743)

Discover related pathways, diseases and genes to CEACAM1/CD66a Antibody (NBP1-85743). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEACAM1/CD66a Antibody (NBP1-85743)

Discover more about diseases related to CEACAM1/CD66a Antibody (NBP1-85743).
 

Pathways for CEACAM1/CD66a Antibody (NBP1-85743)

View related products by pathway.

PTMs for CEACAM1/CD66a Antibody (NBP1-85743)

Learn more about PTMs related to CEACAM1/CD66a Antibody (NBP1-85743).
 

Research Areas for CEACAM1/CD66a Antibody (NBP1-85743)

Find related products by research area.

Blogs on CEACAM1/CD66a

There are no specific blogs for CEACAM1/CD66a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEACAM1/CD66a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEACAM1
Entrez