Recombinant Human Cdx1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cdx1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-90 of Human CDX1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CDX1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cdx1 Protein

  • caudal type homeo box transcription factor 1
  • caudal type homeobox 1
  • caudal type homeobox transcription factor 1
  • Caudal-type homeobox protein 1
  • caudal-type homeobox protein CDX1
  • homeobox protein CDX-1
  • MGC116915

Background

CDX1 - caudal type homeo box transcription factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
AF2807
Species: Hu
Applications: WB, IHC
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
AF4885
Species: Mu
Applications: WB, IP
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
H00001044-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Cdx1 Partial Recombinant Protein (H00001044-Q01) (0)

There are no publications for Cdx1 Partial Recombinant Protein (H00001044-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdx1 Partial Recombinant Protein (H00001044-Q01) (0)

There are no reviews for Cdx1 Partial Recombinant Protein (H00001044-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cdx1 Partial Recombinant Protein (H00001044-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cdx1 Products

Bioinformatics Tool for Cdx1 Partial Recombinant Protein (H00001044-Q01)

Discover related pathways, diseases and genes to Cdx1 Partial Recombinant Protein (H00001044-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdx1 Partial Recombinant Protein (H00001044-Q01)

Discover more about diseases related to Cdx1 Partial Recombinant Protein (H00001044-Q01).
 

Pathways for Cdx1 Partial Recombinant Protein (H00001044-Q01)

View related products by pathway.

PTMs for Cdx1 Partial Recombinant Protein (H00001044-Q01)

Learn more about PTMs related to Cdx1 Partial Recombinant Protein (H00001044-Q01).
 

Research Areas for Cdx1 Partial Recombinant Protein (H00001044-Q01)

Find related products by research area.

Blogs on Cdx1

There are no specific blogs for Cdx1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Cdx1 Antibody
NBP1-49538
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cdx1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDX1