Cdx1 Antibody

Product Discontinued

Cdx1 Antibody Summary

• Immunogen: Synthetic peptide towards Cdx1. Peptide sequence ERQVKIWFQNRRAKERKVNKKKQQQQQPLPPTQLPLPLDGTPTPSGPPLG.
• Predicted Species: Human (100%), Rat (100%), Canine (100%), Equine (100%), Bovine (93%), Guinea Pig (100%), Rabbit (93%), Zebrafish (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDX1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000
• Application Notes: This is a rabbit polyclonal antibody against Cdx1 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cdx1 Antibody

• caudal type homeo box transcription factor 1
• caudal type homeobox 1
• caudal type homeobox transcription factor 1
• Caudal-type homeobox protein 1
• caudal-type homeobox protein CDX1
• homeobox protein CDX-1
• MGC116915

Background

The transcription factors Cdx1 and Cdx2 are members of the caudal-related homeobox gene family based on their homology to the factor caudal in Drosophila melanogaster. The caudal homeobox factor is required for anterior-posterior regional identity and axial patterning in Drosophila. During mouse development, the expression of Cdx1 and Cdx2 can be divided into two stages that likely reflect distinct roles. During early development, these two factors are expressed in a Hox-like manner in the three germ layers and appear to have overlapping functions in anterior-posterior patterning and posterior axis elongation. The second stage of Cdx1 and Cdx2 expression, from late development into adulthood, is characterized by the loss of expression almost everywhere but the epithelium of small intestine and colon. Putative intestine-specific enhancers upstream of the CDX1 gene have been identified that may orchestrate the switch in expression patterns for that gene. As might be expected from this pattern of expression, a wide variety of in vivo and in vitro studies have suggested that these two factors are important in controlling epithelial cell differentiation, proliferation, and function in the intestine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Cdx1 Antibody (NBP1-82398). (Showing 1 - 1 of 1 FAQ).

1. Our customer received Cat.# NBP1-82398, Lot.# QC10831 (PO# EM13091781) But, there was empty vial. There was no evidence of any redundant.
   • Our Cdx1 antibody with catalogue number NBP1-82398 is supplied as a lyophilised product, and as it is sold as a 0.05mg amount it will be hard to see the powder in the vial, especially following transit. To reconstitute the antibody, the customer should centrifuge the vial and then add 50ul of distilled water. The final Cdx1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.

Bioinformatics

• Gene Symbol: CDX1
• Uniprot:
  • NP_034010(Mouse)