Cdx1 Antibody (3A3)

Images

 
Immunocytochemistry/ Immunofluorescence: Cdx1 Antibody (3A3) [H00001044-M03] - Analysis of monoclonal antibody to CDX1 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: Cdx1 Antibody (3A3) [H00001044-M03] - Detection limit for recombinant GST tagged CDX1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
3A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cdx1 Antibody (3A3) Summary

Immunogen
CDX1 (NP_001795 126 a.a. - 215 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK
Specificity
CDX1 (3A3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cdx1 Antibody (3A3)

  • caudal type homeo box transcription factor 1
  • caudal type homeobox 1
  • caudal type homeobox transcription factor 1
  • Caudal-type homeobox protein 1
  • caudal-type homeobox protein CDX1
  • homeobox protein CDX-1
  • MGC116915

Background

This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
AF2807
Species: Hu
Applications: WB, IHC
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
AF4885
Species: Mu
Applications: WB, IP
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
H00001044-M03
Species: Hu
Applications: ELISA, ICC/IF

Publications for Cdx1 Antibody (H00001044-M03) (0)

There are no publications for Cdx1 Antibody (H00001044-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdx1 Antibody (H00001044-M03) (0)

There are no reviews for Cdx1 Antibody (H00001044-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cdx1 Antibody (H00001044-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cdx1 Products

Bioinformatics Tool for Cdx1 Antibody (H00001044-M03)

Discover related pathways, diseases and genes to Cdx1 Antibody (H00001044-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdx1 Antibody (H00001044-M03)

Discover more about diseases related to Cdx1 Antibody (H00001044-M03).
 

Pathways for Cdx1 Antibody (H00001044-M03)

View related products by pathway.

PTMs for Cdx1 Antibody (H00001044-M03)

Learn more about PTMs related to Cdx1 Antibody (H00001044-M03).
 

Research Areas for Cdx1 Antibody (H00001044-M03)

Find related products by research area.

Blogs on Cdx1

There are no specific blogs for Cdx1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdx1 Antibody (3A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDX1
Entrez
OMIM
Uniprot