Cdx1 Antibody (1F12)

Product Discontinued

Cdx1 Antibody (1F12) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CDX1 (NP_001795 126 a.a. - 215 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK
• Specificity: CDX1 - caudal type homeobox transcription factor 1
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CDX1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cdx1 Antibody (1F12)

• caudal type homeo box transcription factor 1
• caudal type homeobox 1
• caudal type homeobox transcription factor 1
• Caudal-type homeobox protein 1
• caudal-type homeobox protein CDX1
• homeobox protein CDX-1
• MGC116915

Background

This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDX1
• Entrez:
  • 1044(Human)
• OMIM:
  • 600746(Human)
• Uniprot:
  • NP_001795(Human)