![Immunocytochemistry/Immunofluorescence: CDV3 Antibody [NBP1-81780] - Staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/fullsize/CDV3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81780-img0004.jpg "Immunocytochemistry/Immunofluorescence: CDV3 Antibody [NBP1-81780] - Staining of human cell line U-2 OS shows localization to cytosol.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit CDV3 Antibody - BSA Free (NBP1-81780) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDPGDNWEE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDV3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDV3 |
![Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining of human liver.](http://images.novusbio.com/fullsize/CDV3-Antibody-Immunohistochemistry-Paraffin-NBP1-81780-img0010.jpg "Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining of human liver.")
![Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining of human tonsil shows distinct cytoplasmic positivity in reaction center cells.](http://images.novusbio.com/fullsize/CDV3-Antibody-Immunohistochemistry-Paraffin-NBP1-81780-img0002.jpg "Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining of human tonsil shows distinct cytoplasmic positivity in reaction center cells.")
![Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/CDV3-Antibody-Immunohistochemistry-Paraffin-NBP1-81780-img0005.jpg "Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining in human tonsil and pancreas tissues using anti-CDV3 antibody. Corresponding CDV3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CDV3-Antibody-Immunohistochemistry-Paraffin-NBP1-81780-img0006.jpg "Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining in human tonsil and pancreas tissues using anti-CDV3 antibody. Corresponding CDV3 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining of human cerebral cortex, liver, lymph node and tonsil using Anti-CDV3 antibody NBP1-81780 (A) shows similar protein distribution across tissues to independent antibody NBP1-81779 (B).](http://images.novusbio.com/fullsize/CDV3-Antibody-Immunohistochemistry-Paraffin-NBP1-81780-img0007.jpg "Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining of human cerebral cortex, liver, lymph node and tonsil using Anti-CDV3 antibody NBP1-81780 (A) shows similar protein distribution across tissues to independent antibody NBP1-81779 (B).")
![Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/CDV3-Antibody-Immunohistochemistry-Paraffin-NBP1-81780-img0008.jpg "Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining of human lymph node.](http://images.novusbio.com/fullsize/CDV3-Antibody-Immunohistochemistry-Paraffin-NBP1-81780-img0009.jpg "Immunohistochemistry-Paraffin: CDV3 Antibody [NBP1-81780] - Staining of human lymph node.")
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RI_AF3025_Western_Blot_17081.jpg)
![Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RI_AF3025_Immunocytochemistry_9948.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images/af3025_human-tgf-beta-ri-alk-5-affinity-purified-polyclonal-ab-41202412402510.jpg)
![Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Western_Blot_10905.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")