CDS2 Antibody (2B9)


Western Blot: CDS2 Antibody (2B9) [H00008760-M01] - CDS2 monoclonal antibody (M01), clone 2B9. Analysis of CDS2 expression in human kidney.
ELISA: CDS2 Antibody (2B9) [H00008760-M01] - Detection limit for recombinant GST tagged CDS2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

CDS2 Antibody (2B9) Summary

CDS2 (NP_003809, 1 a.a. - 67 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK
CDS2 - CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDS2 Antibody (2B9)

  • CDP-DAG synthase 2
  • CDP-DG synthase 2
  • CDP-DG synthetase 2
  • CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
  • CDP-diacylglycerol synthase 2
  • CDP-diglyceride diphosphorylase 2
  • CDP-diglyceride pyrophosphorylase 2
  • CDP-diglyceride synthase 2
  • CDP-diglyceride synthetase 2
  • CDS 2
  • CTP:phosphatidate cytidylyltransferase 2
  • EC 2.7.7
  • EC
  • FLJ38111
  • phosphatidate cytidylyltransferase 2


Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. This gene encodes an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis. Two genes encoding this enzyme have been identified in humans, one mapping to human chromosome 4q21 and a second to 20p13.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, IHC, IHC-P, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, Flow, CyTOF-ready, Neut
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for CDS2 Antibody (H00008760-M01) (0)

There are no publications for CDS2 Antibody (H00008760-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDS2 Antibody (H00008760-M01) (0)

There are no reviews for CDS2 Antibody (H00008760-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDS2 Antibody (H00008760-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CDS2 Products

Bioinformatics Tool for CDS2 Antibody (H00008760-M01)

Discover related pathways, diseases and genes to CDS2 Antibody (H00008760-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDS2 Antibody (H00008760-M01)

Discover more about diseases related to CDS2 Antibody (H00008760-M01).

Pathways for CDS2 Antibody (H00008760-M01)

View related products by pathway.

Blogs on CDS2

There are no specific blogs for CDS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDS2 Antibody (2B9) and receive a gift card or discount.


Gene Symbol CDS2