CDS2 Antibody (2B9) - Azide and BSA Free

Western Blot: CDS2 Antibody (2B9) [H00008760-M01] - CDS2 monoclonal antibody (M01), clone 2B9. Analysis of CDS2 expression in human kidney.

ELISA: CDS2 Antibody (2B9) [H00008760-M01] - Detection limit for recombinant GST tagged CDS2 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2B9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CDS2 Antibody (2B9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CDS2 (NP_003809, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK
• Specificity: CDS2 - CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CDS2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDS2 Antibody (2B9) - Azide and BSA Free

• CDP-DAG synthase 2
• CDP-DG synthase 2
• CDP-DG synthetase 2
• CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
• CDP-diacylglycerol synthase 2
• CDP-diglyceride diphosphorylase 2
• CDP-diglyceride pyrophosphorylase 2
• CDP-diglyceride synthase 2
• CDP-diglyceride synthetase 2
• CDS 2
• CTP:phosphatidate cytidylyltransferase 2
• EC 2.7.7
• EC 2.7.7.41
• FLJ38111
• phosphatidate cytidylyltransferase 2

Background

Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. This gene encodes an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis. Two genes encoding this enzyme have been identified in humans, one mapping to human chromosome 4q21 and a second to 20p13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CDS2 Antibody (H00008760-M01)(1)

Publication using H00008760-M01

• Barneda D, Janardan V, Niewczas I et al. Acyl chain selection couples the consumption and synthesis of phosphoinositides The EMBO journal 2022-06-30 [PMID: 35771169] (WB, Human)

Bioinformatics

• Gene Symbol: CDS2
• Entrez:
  • 8760(Human)
• OMIM:
  • 603549(Human)
• Uniprot:
  • NP_003809(Human)