Cdk9 Recombinant Protein Antigen

Images

 
There are currently no images for Cdk9 Protein (NBP1-86808PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cdk9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDK9.

Source: E. coli

Amino Acid Sequence: HQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDK9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86808.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cdk9 Recombinant Protein Antigen

  • C-2K
  • CDC2L4
  • CDC2L4CTK1
  • CDC2-related kinase
  • Cdk9
  • Cell division cycle 2-like protein kinase 4
  • Cell division protein kinase 9
  • cyclin-dependent kinase 9 (CDC2-related kinase)
  • cyclin-dependent kinase 9
  • EC 2.7.11
  • EC 2.7.11.22
  • EC 2.7.11.23
  • PITALRE
  • serine/threonine protein kinase PITALRE
  • Serine/threonine-protein kinase PITALRE
  • TAK

Background

CDK9 (PITALRE) (also known as cyclin-dependent kinase 9, Serine/threonine-protein kinase PITALRE, C-2K and Cell division cycle 2-like protein kinase 4) is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. CDK9 (PITALRE) interacts with a conserved domain in the TRAF-C region of the tumor necrosis factor signal transducer TRAF2. This kinase also was found to be a component of the multiprotein complex TAK/P-TEFb, which is an elongation factor for RNA polymerase II-directed transcription and functions by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. This protein forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. HIV-1 Tat protein was found to interact with this protein and cyclin T, which suggested a possible involvement of this protein in AIDS. Tat stimulates human HIV-1 viral transcription elongation. This suggests that cyclin T1/cdk9(PITALRE) is one of the HIV-1 required host cellular cofactors generated during T cell activation. Cyclin T1/cdk9(PITALRE) is shown to interact with Tat to restore Tat activation in HeLa nuclear extracts depleted of P-TEFb. The cdk9(PITALRE) activity and cyclin T1 are essential for activation of transcription when tethered to the heterologous Rev response element RNA via the regulator of expression of virion Rev. CDK9 (PITALRE) is a ubiquitously expressed nuclear protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-05509
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-48860
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-95202
Species: Hu, Mu, Rt
Applications: WB
AF4654
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NB100-581
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
NBP1-87592
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, KO, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88376
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF8106
Species: Hu
Applications: IHC, WB
NBP1-06519
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
H00001024-M03
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-86808PEP
Species: Hu
Applications: AC

Publications for Cdk9 Protein (NBP1-86808PEP) (0)

There are no publications for Cdk9 Protein (NBP1-86808PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdk9 Protein (NBP1-86808PEP) (0)

There are no reviews for Cdk9 Protein (NBP1-86808PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cdk9 Protein (NBP1-86808PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cdk9 Products

Research Areas for Cdk9 Protein (NBP1-86808PEP)

Find related products by research area.

Blogs on Cdk9

There are no specific blogs for Cdk9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cdk9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK9