We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Cdk7 Recombinant Protein Antigen

Images

 
There are currently no images for Cdk7 Recombinant Protein Antigen (NBP3-21225PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cdk7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cdk7

Source: E.coli

Amino Acid Sequence: GCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDK7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21225. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cdk7 Recombinant Protein Antigen

  • CAK1Xenopus laevis, cdk-activating kinase)
  • Cdk7
  • CDK-activating kinase
  • CDKN7
  • Cell division protein kinase 7
  • cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase)
  • cyclin-dependent kinase 7
  • EC 2.7.11
  • EC 2.7.11.22
  • EC 2.7.11.23
  • EC 2.7.11.24
  • MO15
  • p39 Mo15
  • serine/threonine kinase stk1,39 kDa protein kinase
  • serine/threonine protein kinase 1
  • serine/threonine protein kinase MO15
  • STK1
  • TFIIH basal transcription factor complex kinase subunit

Background

Cdk7 is encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00000902-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB100-61060
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
NBP2-87539
Species: Hu
Applications: IHC,  IHC-P, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP3-04644
Species: Hu, Mu
Applications: ELISA, WB
NBP3-46159
Species: Hu, Mu, Rt
Applications: ELISA, IHC
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-06477
Species: Hu
Applications: ICC/IF, IP, WB
AF5588
Species: Hu, Mu
Applications: IHC, WB
NBP3-15345
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-31541
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-15704
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-87262
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF1555
Species: Hu
Applications: WB
NBP3-21225PEP
Species: Hu
Applications: AC

Publications for Cdk7 Recombinant Protein Antigen (NBP3-21225PEP) (0)

There are no publications for Cdk7 Recombinant Protein Antigen (NBP3-21225PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdk7 Recombinant Protein Antigen (NBP3-21225PEP) (0)

There are no reviews for Cdk7 Recombinant Protein Antigen (NBP3-21225PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cdk7 Recombinant Protein Antigen (NBP3-21225PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cdk7 Products

Research Areas for Cdk7 Recombinant Protein Antigen (NBP3-21225PEP)

Find related products by research area.

Blogs on Cdk7

There are no specific blogs for Cdk7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cdk7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK7