Cdk7 Antibody

Images

 
Western Blot: Cdk7 Antibody [H00001022-D01P] - Analysis of CDK7 expression in human pancreas.
Western Blot: Cdk7 Antibody [H00001022-D01P] - Analysis of CDK7 expression in transfected 293T cell line by CDK7 polyclonal antibody.Lane 1: CDK7 transfected lysate(39.00 KDa).Lane 2: Non-transfected lysate.
Proximity Ligation Assay: Cdk7 Antibody [H00001022-D01P] - Analysis of protein-protein interactions between CDK7 and E2F1. HeLa cells were stained with anti-CDK7 rabbit purified polyclonal 1:1200 and anti-E2F1 mouse ...read more
Proximity Ligation Assay: Cdk7 Antibody [H00001022-D01P] - Analysis of protein-protein interactions between CDK7 and E2F1. Huh7 cells were stained with anti-CDK7 rabbit purified polyclonal 1:1200 and anti-E2F1 mouse ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cdk7 Antibody Summary

Immunogen
CDK7 (NP_001790.1, 1 a.a. - 346 a.a.) full-length human protein. MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Specificity
CDK7 - cyclin-dependent kinase 7,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDK7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cdk7 Antibody

  • CAK1Xenopus laevis, cdk-activating kinase)
  • CDK-activating kinase
  • Cell division protein kinase 7
  • cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase)
  • cyclin-dependent kinase 7
  • EC 2.7.11
  • EC 2.7.11.22
  • EC 2.7.11.23
  • EC 2.7.11.24
  • p39 Mo15
  • serine/threonine kinase stk1,39 kDa protein kinase
  • serine/threonine protein kinase 1
  • serine/threonine protein kinase MO15
  • TFIIH basal transcription factor complex kinase subunit

Background

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBL1-11392
Species: Hu
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81257
Species: Hu
Applications: IHC, IHC-P
AF5588
Species: Hu, Mu
Applications: WB, IHC
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3296
Species: Hu, Mu, Rt
Applications: WB
NBP1-87262
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF1555
Species: Hu
Applications: WB
H00001022-D01P
Species: Hu
Applications: WB, PLA

Publications for Cdk7 Antibody (H00001022-D01P) (0)

There are no publications for Cdk7 Antibody (H00001022-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdk7 Antibody (H00001022-D01P) (0)

There are no reviews for Cdk7 Antibody (H00001022-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cdk7 Antibody (H00001022-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cdk7 Products

Bioinformatics Tool for Cdk7 Antibody (H00001022-D01P)

Discover related pathways, diseases and genes to Cdk7 Antibody (H00001022-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdk7 Antibody (H00001022-D01P)

Discover more about diseases related to Cdk7 Antibody (H00001022-D01P).
 

Pathways for Cdk7 Antibody (H00001022-D01P)

View related products by pathway.

PTMs for Cdk7 Antibody (H00001022-D01P)

Learn more about PTMs related to Cdk7 Antibody (H00001022-D01P).
 

Research Areas for Cdk7 Antibody (H00001022-D01P)

Find related products by research area.

Blogs on Cdk7

There are no specific blogs for Cdk7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdk7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK7
Entrez
Uniprot