CDK4 Antibody


Western Blot: CDK4 Antibody [NBP2-32288] - Reccomended Titration: 1.0 ug/ml Positive Control: HepG2 Whole Cell
Immunohistochemistry: CDK4 Antibody [NBP2-32288] - Paraffin Embedded Tissue: Human Heart cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Western Blot: CDK4 Antibody [NBP2-32288] - Western blot analysis of HeLa (A) and K562 (B) cell lysate using Cdk4 antibody (NBP2-32288) at 2ug/ml.
Western Blot: CDK4 Antibody [NBP2-32288] - Lanes: 1. 30 ug human HCT116 cell lysate 2. 30 ug genotoxic treated human HCT116 cell lysate 3. 30 ug genotoxic treated human HCT116 cell lysate Primary, Antibody Dilution: 1 : more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CDK4 Antibody Summary

Synthetic peptide within the following C-term region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:2000
  • Immunohistochemistry 4-8 ug/ml
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
CDK4 Lysate (NBP2-66179)
Read Publication using
NBP2-32288 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS and 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CDK4 Antibody

  • CDK4
  • Cell division protein kinase 4
  • CMM3
  • cyclin-dependent kinase 4
  • EC 2.7.11
  • EC
  • melanoma cutaneous malignant, 3
  • MGC14458
  • PSK-J3
  • PSK-J3cell division kinase 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CDK4 Antibody (NBP2-32288)(1)

Reviews for CDK4 Antibody (NBP2-32288) (0)

There are no reviews for CDK4 Antibody (NBP2-32288). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDK4 Antibody (NBP2-32288) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional CDK4 Products

Bioinformatics Tool for CDK4 Antibody (NBP2-32288)

Discover related pathways, diseases and genes to CDK4 Antibody (NBP2-32288). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDK4 Antibody (NBP2-32288)

Discover more about diseases related to CDK4 Antibody (NBP2-32288).

Pathways for CDK4 Antibody (NBP2-32288)

View related products by pathway.

PTMs for CDK4 Antibody (NBP2-32288)

Learn more about PTMs related to CDK4 Antibody (NBP2-32288).

Research Areas for CDK4 Antibody (NBP2-32288)

Find related products by research area.

Blogs on CDK4

There are no specific blogs for CDK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDK4 Antibody and receive a gift card or discount.


Gene Symbol CDK4