CDK4 Antibody (6N3M6)

Western Blot: CDK4 Antibody (3G7Q7) [NBP3-15344] - Western blot analysis of extracts of MCF7 cells, using CDK4 Rabbit mAb (NBP3-15344) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/Immunofluorescence: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunofluorescence analysis of HeLa cells using CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunohistochemistry of paraffin-embedded rat ovary using [KO Validated] CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunohistochemistry of paraffin-embedded human breast cancer using [KO Validated] CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunohistochemistry of paraffin-embedded human colon carcinoma using [KO Validated] CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunohistochemistry of paraffin-embedded mouse lung using [KO Validated] CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunohistochemistry of paraffin-embedded mouse spleen using [KO Validated] CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunohistochemistry of paraffin-embedded rat lung using [KO Validated] CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Western Blot: CDK4 Antibody (6N3M6) [CDK4] - Western blot analysis of various lysates, using CDK4 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Immunohistochemistry: CDK4 Antibody (6N3M6) [CDK4] - Immunohistochemistry analysis of paraffin-embedded Human prostate tissue using [KO Validated] CDK4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: CDK4 Antibody (6N3M6) [NBP3-15344] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KO Validated] CDK4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: CDK4 Antibody (6N3M6) [NBP3-15344] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KO Validated] CDK4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: CDK4 Antibody (6N3M6) [NBP3-15344] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KO Validated] CDK4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: CDK4 Antibody (6N3M6) [NBP3-15344] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using [KO Validated] CDK4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 6N3M6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CDK4 Antibody (6N3M6) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1). FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CDK4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:100 - 1:500
  • Immunohistochemistry-Paraffin 1:100 - 1:500
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for CDK4 Antibody (6N3M6)

• CDK4
• Cell division protein kinase 4
• CMM3
• cyclin-dependent kinase 4
• EC 2.7.11
• EC 2.7.11.22
• melanoma cutaneous malignant, 3
• MGC14458
• PSK-J3
• PSK-J3cell division kinase 4

Background

Cdk4 is encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDK4