CDK20 Antibody (3E11) - Azide and BSA Free

Western Blot: CDK20 Antibody (3E11) [H00023552-M13] - Analysis of CCRK expression in transfected 293T cell line by CCRK monoclonal antibody (M13), clone 3E11. Lane 1: CCRK transfected lysatE (30.6 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: CDK20 Antibody (3E11) [H00023552-M13] - Detection limit for recombinant GST tagged CCRK is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3E11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CDK20 Antibody (3E11) - Azide and BSA Free Summary

• Immunogen: CCRK (AAH02655.1, 183 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIA
• Specificity: CCRK - cell cycle related kinase (3E11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CDK20
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDK20 Antibody (3E11) - Azide and BSA Free

• CAK-kinase p42
• CCRK
• CCRKEC 2.7.11.22
• CDCH
• CDCHP42
• CDK20
• CDK-activating kinase p42
• cell cycle related kinase
• Cell cycle-related kinase
• Cell division protein kinase 20
• cyclin-dependent kinase 20
• Cyclin-dependent protein kinase H
• Cyclin-kinase-activating kinase p42
• EC 2.7.11
• p42
• PNQALRE

Background

The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase activates CDK2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDK20
• Entrez:
  • 23552(Human)
• Uniprot:
  • AAH02655(Human)