CDK2 Antibody (10E0N5)

Western Blot: CDK2 Antibody (10E0N5) [NBP3-33184] - Western blot analysis of various lysates using CDK2 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Western Blot: CDK2 Antibody (10E0N5) [NBP3-33184] - Western blot analysis of lysates from wild type(WT) and CDK2 knockout (KO) 293T cells, using [KO Validated] CDK2 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 10E0N5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CDK2 Antibody (10E0N5) Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 199-298 of human CDK2 (P24941).
  
  Sequence:
  RRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CDK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CDK2 Antibody (10E0N5)

• cdc2-related protein kinase
• CDK2
• cell devision kinase 2
• Cell division protein kinase 2
• cyclin-dependent kinase 2
• EC 2.7.11
• EC 2.7.11.22
• p33 protein kinase
• p33(CDK2)

Background

The protein encoded by the Cdk2 gene is a member of the Ser/Thr protein kinase family. This protein kinase is highlysimilar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2. It is a catalytic subunit of thecyclin-dependent protein kinase complex, whose activity is restricted to the G1-S phase, and essential for cell cycleG1/S phase transition. This protein associates with and regulated by the regulatory subunits of the complex includingcyclin A or E, CDK inhibitor p21Cip1 (CDKN1A) and p27Kip1 (CDKN1B). Its activity is also regulated by its proteinphosphorylation. Two alternatively spliced variants and multiple transcription initiation sites of this gene have beenreported. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDK2