CDC42SE1 Antibody

Images

 
Immunohistochemistry-Paraffin: CDC42SE1 Antibody [NBP1-80780] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDC42SE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNR
Specificity
Specificity of human CDC42SE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC42SE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDC42SE1 Antibody

  • 1300002M12Rik
  • CDC42 small effector 1
  • CDC42-binding protein SCIP1
  • SCIP1
  • signaling molecule SPEC1 beta
  • Small effector of CDC42 protein 1
  • small protein effector 1 of Cdc42
  • SPEC1CDC42 small effector protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82131
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-67413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-98474
Species: Hu
Applications: WB
NBP2-47123
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-67091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00030008-B01P
Species: Hu
Applications: WB, ELISA, Flow
NBL1-14964
Species: Hu
H00079977-A01
Species: Hu
Applications: WB, ELISA
H00051592-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13350
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-80780
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for CDC42SE1 Antibody (NBP1-80780) (0)

There are no publications for CDC42SE1 Antibody (NBP1-80780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42SE1 Antibody (NBP1-80780) (0)

There are no reviews for CDC42SE1 Antibody (NBP1-80780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CDC42SE1 Antibody (NBP1-80780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CDC42SE1 Products

Bioinformatics Tool for CDC42SE1 Antibody (NBP1-80780)

Discover related pathways, diseases and genes to CDC42SE1 Antibody (NBP1-80780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC42SE1 Antibody (NBP1-80780)

Discover more about diseases related to CDC42SE1 Antibody (NBP1-80780).

Blogs on CDC42SE1

There are no specific blogs for CDC42SE1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC42SE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42SE1
Entrez
Uniprot
COVID-19 update