CDC42SE1 Antibody

Images

 
Immunohistochemistry-Paraffin: CDC42SE1 Antibody [NBP1-80780] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDC42SE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNR
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC42SE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100.
Control Peptide
CDC42SE1 Protein (NBP1-80780PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDC42SE1 Antibody

  • 1300002M12Rik
  • CDC42 small effector 1
  • CDC42-binding protein SCIP1
  • SCIP1
  • signaling molecule SPEC1 beta
  • Small effector of CDC42 protein 1
  • small protein effector 1 of Cdc42
  • SPEC1CDC42 small effector protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46191
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-47123
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
423-F8
Species: Hu, Mu
Applications: BA
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00030008-B01P
Species: Hu
Applications: Flow, WB
5444-SL
Species: Mu
Applications: BA
NBL1-14964
Species: Hu
Applications: WB
NBP1-88552
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00051592-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-86641
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB3629
Species: Mu
Applications: IHC
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47525
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80780
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for CDC42SE1 Antibody (NBP1-80780) (0)

There are no publications for CDC42SE1 Antibody (NBP1-80780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42SE1 Antibody (NBP1-80780) (0)

There are no reviews for CDC42SE1 Antibody (NBP1-80780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CDC42SE1 Antibody (NBP1-80780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDC42SE1 Products

Bioinformatics Tool for CDC42SE1 Antibody (NBP1-80780)

Discover related pathways, diseases and genes to CDC42SE1 Antibody (NBP1-80780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC42SE1 Antibody (NBP1-80780)

Discover more about diseases related to CDC42SE1 Antibody (NBP1-80780).

Blogs on CDC42SE1

There are no specific blogs for CDC42SE1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC42SE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42SE1
Entrez
Uniprot