CDC42EP3 Antibody

Immunocytochemistry/Immunofluorescence: CDC42EP3 Antibody [NBP2-68779] - Staining of human cell line LHCN-M2 shows localization to plasma membrane & actin filaments.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CDC42EP3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNA
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDC42EP3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  CDC42EP3 Recombinant Protein Antigen (NBP2-68779PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for CDC42EP3 Antibody

• Binder of Rho GTPases 2
• BORG2CEP3UB1
• CDC42 effector protein (Rho GTPase binding) 3
• cdc42 effector protein 3
• CRIB-containing BORG2 protein
• FLJ46903
• MSE55-related Cdc42-binding protein
• MSE55-related protein

Background

CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of, CDC42. This protein can interact with CDC42, as well as with the ras homolog gene family, member Q (ARHQ/TC10). Expression of this protein in fibroblasts has been shown to induce pseudopodia formation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDC42EP3