Cdc23 Antibody

Images

 
Immunohistochemistry-Paraffin: Cdc23 Antibody [NBP1-89093] - Staining of human tonsil shows cytoplasmic and nuclear positivity in germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cdc23 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cdc23 Protein (NBP1-89093PEP)
Publications
Read Publication using NBP1-89093.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cdc23 Antibody

  • ANAPC8anaphase promoting complex subunit 8
  • Anaphase-promoting complex subunit 8
  • APC8CDC23 (cell division cycle 23, yeast, homolog)
  • cell division cycle 23 homolog (S. cerevisiae)
  • cell division cycle protein 23 homolog
  • CUT23
  • Cyclosome subunit 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-77155
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-253
Species: Hu
Applications: WB, IP
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-77157
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-77375
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-57669
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-01128
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4497
Species: Hu
Applications: WB, Simple Western
NBP2-20389
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45493
Species: Hu, Mk
Applications: WB, IHC, IF
NBP1-82886
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP1-89093
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Cdc23 Antibody (NBP1-89093)(1)

Reviews for Cdc23 Antibody (NBP1-89093) (0)

There are no reviews for Cdc23 Antibody (NBP1-89093). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cdc23 Antibody (NBP1-89093) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cdc23 Products

Bioinformatics Tool for Cdc23 Antibody (NBP1-89093)

Discover related pathways, diseases and genes to Cdc23 Antibody (NBP1-89093). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdc23 Antibody (NBP1-89093)

Discover more about diseases related to Cdc23 Antibody (NBP1-89093).
 

Pathways for Cdc23 Antibody (NBP1-89093)

View related products by pathway.

PTMs for Cdc23 Antibody (NBP1-89093)

Learn more about PTMs related to Cdc23 Antibody (NBP1-89093).
 

Research Areas for Cdc23 Antibody (NBP1-89093)

Find related products by research area.

Blogs on Cdc23

There are no specific blogs for Cdc23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdc23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC23