CD8 beta Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CD8 beta Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD8 beta.

  Source: E. coli

  Amino Acid Sequence: EGISGTFVPQCLHGYYSNTTTSQKLLNPWILK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CD8B
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58425.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD8 beta Recombinant Protein Antigen

• CD8 antigen, beta polypeptide 1 (p37)
• CD8 beta
• CD8b antigen
• CD8b molecule
• CD8b
• CD8B1
• CD8B1P37
• Leu2
• LY3
• LYT3
• MGC119115
• P37
• T lymphocyte surface glycoprotein beta chain
• T-cell surface glycoprotein CD8 beta chain

Background

CD8b antigen is also known as T8, Lyt2, Ly-2, and CD8 beta. It is a member of the immunoglobulin superfamily expressed on most thymocytes, some mature T cell subsets, and macrophages. CD8b forms heterodimers with the CD8 alpha chain (CD8a). CD8 is an antigen co-receptor on T cells that interacts with MHC class I on antigen-presenting cells or epithelial cells. CD8 participates in T cell activation through its association with the T cell receptor complex and protein tyrosine kinase lck (p56lck).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CD8B