CD59 Antibody


Orthogonal Strategies: Western Blot: CD59 Antibody [NBP1-89405] - Analysis in human cell lines PC-3 and Caco-2 using anti-CD59 antibody. Corresponding CD59 RNA-seq data are presented for the same cell lines. more
Immunocytochemistry/ Immunofluorescence: CD59 Antibody [NBP1-89405] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: CD59 Antibody [NBP1-89405] - Staining of human urinary bladder shows distinct membranous positivity in urothelial cells.
Western Blot: CD59 Antibody [NBP1-89405] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

CD59 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG
Specificity of human CD59 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CD59 Protein (NBP1-89405PEP)
Read Publication using NBP1-89405.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CD59 Antibody

  • 16.3A5
  • 1F5 antigen
  • 1F5
  • 20 kDa homologous restriction factor
  • CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16
  • CD59 antigen
  • CD59 antigen, complement regulatory protein
  • CD59 glycoprotein
  • CD59 molecule, complement regulatory protein
  • CD59
  • EJ16
  • EJ30
  • EJ30, EL32 and G344)
  • EL32
  • FLJ38134
  • FLJ92039
  • G344
  • HRF20
  • HRF-20
  • human leukocyte antigen MIC11
  • Ly-6-like protein
  • lymphocytic antigen CD59/MEM43
  • MAC-inhibitory protein
  • MAC-IP
  • MEM43 antigen
  • MEM43
  • membrane attack complex (MAC) inhibition factor
  • Membrane attack complex inhibition factor
  • Membrane inhibitor of reactive lysis
  • MGC2354
  • MIC11
  • MIC11MSK21
  • MIN1
  • MIN2
  • MIN3
  • MIRL
  • p18-20
  • Protectin
  • surface anitgen recognized by monoclonal 16.3A5
  • T cell-activating protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Simple Western
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CD59 Antibody (NBP1-89405)(1)

Reviews for CD59 Antibody (NBP1-89405) (0)

There are no reviews for CD59 Antibody (NBP1-89405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CD59 Antibody (NBP1-89405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CD59 Products

Bioinformatics Tool for CD59 Antibody (NBP1-89405)

Discover related pathways, diseases and genes to CD59 Antibody (NBP1-89405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD59 Antibody (NBP1-89405)

Discover more about diseases related to CD59 Antibody (NBP1-89405).

Pathways for CD59 Antibody (NBP1-89405)

View related products by pathway.

PTMs for CD59 Antibody (NBP1-89405)

Learn more about PTMs related to CD59 Antibody (NBP1-89405).

Research Areas for CD59 Antibody (NBP1-89405)

Find related products by research area.

Blogs on CD59

There are no specific blogs for CD59, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD59 Antibody and receive a gift card or discount.


Gene Symbol CD59