CD59 Antibody - BSA Free

Western Blot: CD59 Antibody [NBP1-89405] - Analysis in human cell lines PC-3 and Caco-2 using anti-CD59 antibody. Corresponding CD59 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.

Immunocytochemistry/Immunofluorescence: CD59 Antibody [NBP1-89405] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.

Staining of human pancreas shows strong membranous positivity in ductal cells.

Staining of human fallopian tube shows strong positivity in cilia in glandular cells.

Staining of human testis shows moderate membranous positivity in Leydig cells.

Staining of human placenta shows strong membranous positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD59 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD59 Antibody - BSA Free (NBP1-89405) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CD59 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD59
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CD59 Recombinant Protein Antigen (NBP1-89405PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CD59 Antibody - BSA Free

• 16.3A5
• 1F5 antigen
• 1F5
• 20 kDa homologous restriction factor
• CD59 antigen
• CD59 antigen, complement regulatory protein
• CD59 glycoprotein
• CD59 molecule, complement regulatory protein
• CD59
• EJ16
• EJ30
• EJ30, EL32 and G344)
• EL32
• FLJ38134
• FLJ92039
• G344
• HRF20
• HRF-20
• human leukocyte antigen MIC11
• Ly-6-like protein
• lymphocytic antigen CD59/MEM43
• MACIF
• MAC-inhibitory protein
• MAC-IP
• MEM43 antigen
• MEM43
• membrane attack complex (MAC) inhibition factor
• Membrane attack complex inhibition factor
• Membrane inhibitor of reactive lysis
• MGC2354
• MIC11
• MIC11MSK21
• MIN1
• MIN2
• MIN3
• MIRL
• p18-20
• Protectin
• surface anitgen recognized by monoclonal 16.3A5
• T cell-activating protein

Background

CD59, an LY6 like protein expressed in human lymphoid cells, regulates the action of the complement membrane attack complex on homologous cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CD59 Antibody (NBP1-89405)(2)

Publications using NBP1-89405

• Lin M C, Shen C H et al. Inhibition of human lung adenocarcinoma growth and metastasis by JC polyomavirus-like particles packaged with an SP-B promoter-driven CD59-specific shRNA. Clin Sci (Lond) 2019-11-15 [PMID: 31693732] (WB, Human)
• Miyaji K, Paul F, Shahrizaila N et al. Complement regulatory proteins (CD46, 55 and 59) expressed on Schwann cells: Immune targets in demyelinating neuropathies? J. Neuroimmunol. 2014-08-08 [PMID: 25156074]

Bioinformatics

• Gene Symbol: CD59
• Entrez:
  • 966(Human)
• Uniprot:
  • P13987()