CD5 Recombinant Protein Antigen

Images

 
There are currently no images for CD5 Protein (NBP2-38509PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD5.

Source: E. coli

Amino Acid Sequence: GVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDLGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38509.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD5 Recombinant Protein Antigen

  • CD5 antigen (p56-62)
  • CD5 antigen
  • CD5 molecule
  • CD5
  • LEU1T-cell surface glycoprotein CD5
  • Lymphocyte antigen T1/Leu-1
  • T1

Background

In humans, CD5 is a 55kDa T lymphocyte single chain transmembrane glycoprotein. It is present on all mature T lymphocytes, on most thymocytes and on many T cell leukemias and lymphomas. It reacts with a subpopulation of activated B cells. CD5/Lyt1 antigen is a monomeric type I transmembrane glycoprotein expressed on thymocytes, T lymphocytes, and a subset of B lymphocytes, but not on natural killer (NK) cells. It has been identified as the major ligand of the B cell antigen CD72. The frequency of CD5+ B cells exhibits strain dependent variation, and the phenotypic, anatomical, functional, developmental, and pathological characteristics of the CD5+ B cells suggest that they may represent a distinct lineage, known as B1 cells. Binding of CD5 on the T cell surface can augment alloantigen or mitogen induced lymphocyte proliferation and induces increased cytosolic free calcium, IL2 secretion, and IL2R expression. It has been proposed that CD5 negatively regulates signal transduction mediated by the T cell and B cell receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB4841
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-44634
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
202-IL
Species: Hu
Applications: BA
AF7579
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
MAB123
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
AF4196
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, WB
DR2A00
Species: Hu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
NBP2-16996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB

Publications for CD5 Protein (NBP2-38509PEP) (0)

There are no publications for CD5 Protein (NBP2-38509PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD5 Protein (NBP2-38509PEP) (0)

There are no reviews for CD5 Protein (NBP2-38509PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD5 Protein (NBP2-38509PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD5 Products

Research Areas for CD5 Protein (NBP2-38509PEP)

Find related products by research area.

Blogs on CD5.

How To Identify B Cell Subsets Using Flow Cytometry
By Victoria OsinskiUsing Flow Cytometry to Identify B Cell SubsetsIdentifying cellular subsets by flow cytometry requires careful and thorough planning in order to ensure the correct subset of cells are identified...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD5