Recombinant Human CD43/Sialophorin Protein

Product Discontinued

Recombinant Human CD43/Sialophorin Protein Summary

• Description: An untagged recombinant protein corresponding to the amino acid sequence of (NP_003114.1) for Human CD43/Sialophorin
  
  

  Source: Wheat Germ

  Amino Acid Sequence: MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: SPN
• Purity: >10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Immunoaffinity Purification
• Theoretical MW: 40.3 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 25 mM Tris-HCl pH8.0 in 2% glycerol.
• Preservative: No Preservative
• Purity: >10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD43/Sialophorin Protein

• CD43 antigen
• CD43
• CD43)
• Galactoglycoprotein
• GALGP
• GPL115
• Leukocyte sialoglycoprotein
• Leukosialin
• LSN
• Ly-48
• sialophorin (gpL115, leukosialin, CD43)
• Sialophorin
• SPN

Background

CD43 is a key glycoprotein of thymocytes and T lymphocytes, which affects the physicochemical properties of the T-cell surface and plays a role in lectin binding. This antibody contains an extended rodlike structure that may protrude above the glycocalyx of the cell, allowing accessibility of multiple glycan chains for binding. During T-cell activation CD43 is actively removed from the T-cell-antigen-presenting cell contact site, thus suggesting CD43's role in negative regulation of the adaptive immune response.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SPN