CD39L2/ENTPD6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CD39L2/ENTPD6 Antibody [NBP2-58760] - Staining of human cell line SK-MEL-30 shows localization to the Golgi apparatus.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD39L2/ENTPD6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FFSITRAAPGARWGQQAHSPLGTAADGHEVFYGIMFDAGSTGTRVHVFQFTRPPRETPTLTHETFKALKPGLSAYADDVEKSAQGIRELLDVAKQDIPFDFWKATPLVLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ENTPD6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CD39L2/ENTPD6 Recombinant Protein Antigen (NBP2-58760PEP)

Reactivity Notes

Mouse 85%, Rat 82%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CD39L2/ENTPD6 Antibody - BSA Free

• CD39 antigen-like 2
• CD39L2
• CD39L2NTPDase-6
• CD39-like 2
• dJ738P15.3
• DKFZp781G2277
• DKFZp781K21102
• EC 3.6.1.6
• ectonucleoside triphosphate diphosphohydrolase 6 (putative function)
• ectonucleoside triphosphate diphosphohydrolase 6 (putative)
• ectonucleoside triphosphate diphosphohydrolase 6
• ENTPD6
• FLJ36711
• IL-6SAG
• IL6ST2
• interleukin 6 signal transducer-2
• NTPD3
• NTPDase 6

Background

ENTPD6 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD6 contains 4 apyrase-conserved regions which is characteristic of NTPases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ENTPD6