CD39L2/ENTPD6 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit CD39L2/ENTPD6 Antibody - BSA Free (NBP2-58760) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FFSITRAAPGARWGQQAHSPLGTAADGHEVFYGIMFDAGSTGTRVHVFQFTRPPRETPTLTHETFKALKPGLSAYADDVEKSAQGIRELLDVAKQDIPFDFWKATPLVLK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ENTPD6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CD39L2/ENTPD6 Antibody - BSA Free
Background
ENTPD6 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD6 contains 4 apyrase-conserved regions which is characteristic of NTPases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IP, Simple Western, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Eq, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF
Publications for CD39L2/ENTPD6 Antibody (NBP2-58760) (0)
There are no publications for CD39L2/ENTPD6 Antibody (NBP2-58760).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD39L2/ENTPD6 Antibody (NBP2-58760) (0)
There are no reviews for CD39L2/ENTPD6 Antibody (NBP2-58760).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CD39L2/ENTPD6 Antibody (NBP2-58760) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CD39L2/ENTPD6 Products
Research Areas for CD39L2/ENTPD6 Antibody (NBP2-58760)
Find related products by research area.
|
Blogs on CD39L2/ENTPD6