CD39L2/ENTPD6 Antibody


Immunohistochemistry-Paraffin: CD39L2/ENTPD6 Antibody [NBP2-57315] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CD39L2/ENTPD6 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVD
Specificity of human CD39L2/ENTPD6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD39L2/ENTPD6 Recombinant Protein Antigen (NBP2-57315PEP)

Reactivity Notes

Mouse 83%, Rat 82%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for CD39L2/ENTPD6 Antibody

  • CD39 antigen-like 2
  • CD39L2
  • CD39L2NTPDase-6
  • CD39-like 2
  • dJ738P15.3
  • DKFZp781G2277
  • DKFZp781K21102
  • EC
  • ectonucleoside triphosphate diphosphohydrolase 6 (putative function)
  • ectonucleoside triphosphate diphosphohydrolase 6 (putative)
  • ectonucleoside triphosphate diphosphohydrolase 6
  • ENTPD6
  • FLJ36711
  • IL-6SAG
  • IL6ST2
  • interleukin 6 signal transducer-2
  • NTPD3
  • NTPDase 6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Eq
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IP
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Po, Bv, Xp, Dr(-)
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for CD39L2/ENTPD6 Antibody (NBP2-57315) (0)

There are no publications for CD39L2/ENTPD6 Antibody (NBP2-57315).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD39L2/ENTPD6 Antibody (NBP2-57315) (0)

There are no reviews for CD39L2/ENTPD6 Antibody (NBP2-57315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD39L2/ENTPD6 Antibody (NBP2-57315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional CD39L2/ENTPD6 Products

Bioinformatics Tool for CD39L2/ENTPD6 Antibody (NBP2-57315)

Discover related pathways, diseases and genes to CD39L2/ENTPD6 Antibody (NBP2-57315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD39L2/ENTPD6 Antibody (NBP2-57315)

Discover more about diseases related to CD39L2/ENTPD6 Antibody (NBP2-57315).

Pathways for CD39L2/ENTPD6 Antibody (NBP2-57315)

View related products by pathway.

Research Areas for CD39L2/ENTPD6 Antibody (NBP2-57315)

Find related products by research area.

Blogs on CD39L2/ENTPD6

There are no specific blogs for CD39L2/ENTPD6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD39L2/ENTPD6 Antibody and receive a gift card or discount.


Gene Symbol ENTPD6