CD39L2/ENTPD6 Antibody

Images

 
Immunohistochemistry-Paraffin: CD39L2/ENTPD6 Antibody [NBP2-57315] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD39L2/ENTPD6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVD
Specificity
Specificity of human CD39L2/ENTPD6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ENTPD6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD39L2/ENTPD6 Recombinant Protein Antigen (NBP2-57315PEP)

Reactivity Notes

Mouse 83%, Rat 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CD39L2/ENTPD6 Antibody

  • CD39 antigen-like 2
  • CD39L2
  • CD39L2NTPDase-6
  • CD39-like 2
  • dJ738P15.3
  • DKFZp781G2277
  • DKFZp781K21102
  • EC 3.6.1.6
  • ectonucleoside triphosphate diphosphohydrolase 6 (putative function)
  • ectonucleoside triphosphate diphosphohydrolase 6 (putative)
  • ectonucleoside triphosphate diphosphohydrolase 6
  • ENTPD6
  • FLJ36711
  • IL-6SAG
  • IL6ST2
  • interleukin 6 signal transducer-2
  • NTPD3
  • NTPDase 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85751
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
AF4400
Species: Hu
Applications: WB, IHC
NBP2-48480
Species: Hu
Applications: Flow, IHC-Fr, Flow-CS
NBP1-90071
Species: Hu, Mu, Po, Eq
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85752
Species: Hu
Applications: WB, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87428
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-42813
Species: Dr, Hu(-)
Applications: WB, ICC/IF
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45916
Species: Hu
Applications: WB, IHC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32799
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for CD39L2/ENTPD6 Antibody (NBP2-57315) (0)

There are no publications for CD39L2/ENTPD6 Antibody (NBP2-57315).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD39L2/ENTPD6 Antibody (NBP2-57315) (0)

There are no reviews for CD39L2/ENTPD6 Antibody (NBP2-57315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD39L2/ENTPD6 Antibody (NBP2-57315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CD39L2/ENTPD6 Antibody (NBP2-57315)

Discover related pathways, diseases and genes to CD39L2/ENTPD6 Antibody (NBP2-57315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD39L2/ENTPD6 Antibody (NBP2-57315)

Discover more about diseases related to CD39L2/ENTPD6 Antibody (NBP2-57315).
 

Pathways for CD39L2/ENTPD6 Antibody (NBP2-57315)

View related products by pathway.

Research Areas for CD39L2/ENTPD6 Antibody (NBP2-57315)

Find related products by research area.

Blogs on CD39L2/ENTPD6

There are no specific blogs for CD39L2/ENTPD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD39L2/ENTPD6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ENTPD6