CD30 Ligand/TNFSF8 Antibody

Images

 
Western Blot: CD30 Ligand/TNFSF8 Antibody [H00000944-B01P] - Analysis of TNFSF8 expression in transfected 293T cell line by TNFSF8 polyclonal antibody. Lane 1: TNFSF8 transfected lysate(25.74 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CD30 Ligand/TNFSF8 Antibody Summary

Immunogen
TNFSF8 (NP_001235.1, 1 a.a. - 234 a.a.) full-length human protein. MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Specificity
TNFSF8 - tumor necrosis factor (ligand) superfamily, member 8,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TNFSF8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD30 Ligand/TNFSF8 Antibody

  • CD153 antigen
  • CD153
  • CD30 antigen ligand
  • CD30 Ligand
  • CD30L
  • CD30-L
  • CD30LCD30 ligand
  • CD30LGMGC138144
  • TNFSF8
  • tumor necrosis factor (ligand) superfamily, member 8
  • tumor necrosis factor ligand superfamily member 8

Background

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB2738
Species: Hu
Applications: WB, ICC
MAB10541
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF1246
Species: Mu
Applications: WB
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF3388
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF382
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, Neut
126-FL/CF
Species: Hu
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
H00000944-B01P
Species: Hu
Applications: WB

Publications for CD30 Ligand/TNFSF8 Antibody (H00000944-B01P) (0)

There are no publications for CD30 Ligand/TNFSF8 Antibody (H00000944-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD30 Ligand/TNFSF8 Antibody (H00000944-B01P) (0)

There are no reviews for CD30 Ligand/TNFSF8 Antibody (H00000944-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD30 Ligand/TNFSF8 Antibody (H00000944-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD30 Ligand/TNFSF8 Products

Bioinformatics Tool for CD30 Ligand/TNFSF8 Antibody (H00000944-B01P)

Discover related pathways, diseases and genes to CD30 Ligand/TNFSF8 Antibody (H00000944-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD30 Ligand/TNFSF8 Antibody (H00000944-B01P)

Discover more about diseases related to CD30 Ligand/TNFSF8 Antibody (H00000944-B01P).
 

Pathways for CD30 Ligand/TNFSF8 Antibody (H00000944-B01P)

View related products by pathway.

PTMs for CD30 Ligand/TNFSF8 Antibody (H00000944-B01P)

Learn more about PTMs related to CD30 Ligand/TNFSF8 Antibody (H00000944-B01P).
 

Research Areas for CD30 Ligand/TNFSF8 Antibody (H00000944-B01P)

Find related products by research area.

Blogs on CD30 Ligand/TNFSF8

There are no specific blogs for CD30 Ligand/TNFSF8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD30 Ligand/TNFSF8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFSF8
Entrez
Uniprot