CD30 Ligand/TNFSF8 Antibody

Western Blot: CD30 Ligand/TNFSF8 Antibody [H00000944-B01P] - Analysis of TNFSF8 expression in transfected 293T cell line by TNFSF8 polyclonal antibody. Lane 1: TNFSF8 transfected lysate(25.74 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

CD30 Ligand/TNFSF8 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: TNFSF8 (NP_001235.1, 1 a.a. - 234 a.a.) full-length human protein. MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
• Specificity: TNFSF8 - tumor necrosis factor (ligand) superfamily, member 8,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: TNFSF8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD30 Ligand/TNFSF8 Antibody

• CD153 antigen
• CD153
• CD30 antigen ligand
• CD30 Ligand
• CD30L
• CD30-L
• CD30LCD30 ligand
• CD30LGMGC138144
• TNFSF8
• tumor necrosis factor (ligand) superfamily, member 8
• tumor necrosis factor ligand superfamily member 8

Background

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNFSF8
• Entrez:
  • 944(Human)
• Uniprot:
  • NP_001235.1(Human)