Recombinant Human CD3 delta Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CD3 delta Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 22-100 of Human CD3 delta

Source: Wheat Germ

Amino Acid Sequence: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CD3D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
34.43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD3 delta Protein

  • CD3 antigen, delta subunit
  • CD3d antigen
  • CD3d antigen, delta polypeptide (TiT3 complex)
  • CD3d molecule, delta (CD3-TCR complex)
  • CD3-DELTA
  • T3DOKT3, delta chain
  • T-cell receptor T3 delta chain
  • T-cell surface glycoprotein CD3 delta chain

Background

CD3D - CD3D antigen, delta polypeptide (TiT3 complex)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-32636
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-45883
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-74080
Species: Hu
Applications: WB
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
MAB4841
Species: Mu
Applications: Flow, IHC, IP, CompCytotox, CyTOF-ready, ICC, Tstim
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56620
Species: Hu
Applications: WB
H00000915-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CD3 delta Partial Recombinant Protein (H00000915-Q01) (0)

There are no publications for CD3 delta Partial Recombinant Protein (H00000915-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD3 delta Partial Recombinant Protein (H00000915-Q01) (0)

There are no reviews for CD3 delta Partial Recombinant Protein (H00000915-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD3 delta Partial Recombinant Protein (H00000915-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD3 delta Products

Bioinformatics Tool for CD3 delta Partial Recombinant Protein (H00000915-Q01)

Discover related pathways, diseases and genes to CD3 delta Partial Recombinant Protein (H00000915-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD3 delta Partial Recombinant Protein (H00000915-Q01)

Discover more about diseases related to CD3 delta Partial Recombinant Protein (H00000915-Q01).
 

Pathways for CD3 delta Partial Recombinant Protein (H00000915-Q01)

View related products by pathway.

PTMs for CD3 delta Partial Recombinant Protein (H00000915-Q01)

Learn more about PTMs related to CD3 delta Partial Recombinant Protein (H00000915-Q01).
 

Research Areas for CD3 delta Partial Recombinant Protein (H00000915-Q01)

Find related products by research area.

Blogs on CD3 delta

There are no specific blogs for CD3 delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD3 delta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CD3D