CD163L1 Antibody

Images

 
Immunohistochemistry-Paraffin: CD163L1 Antibody [NBP1-86545] - Staining of human spleen shows strong cytoplasmic positivity in cells of red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD163L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD163L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD163L1 Protein (NBP1-86545PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD163L1 Antibody

  • CD163 antigen B
  • CD163 antigen-like 1
  • CD163 molecule-like 1
  • CD163B
  • M160
  • scavenger receptor cysteine-rich type 1 protein M160
  • UNQ6434/PRO23202

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40686
Species: Hu, Po, Bv, GP, Pm, RM, Sh
Applications: WB, ELISA, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-CS
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB59151
Species: Mu
Applications: WB
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CD6
627-CD
Species: Hu
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBL1-12547
Species: Hu
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF2797
Species: Hu
Applications: WB
NB110-38889
Species: Hu
Applications: WB, IP
AF4779
Species: Hu
Applications: WB, IHC
AF7177
Species: Hu
Applications: WB, ICC
NBP1-86545
Species: Hu
Applications: IHC, IHC-P

Publications for CD163L1 Antibody (NBP1-86545) (0)

There are no publications for CD163L1 Antibody (NBP1-86545).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD163L1 Antibody (NBP1-86545) (0)

There are no reviews for CD163L1 Antibody (NBP1-86545). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD163L1 Antibody (NBP1-86545) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD163L1 Products

Bioinformatics Tool for CD163L1 Antibody (NBP1-86545)

Discover related pathways, diseases and genes to CD163L1 Antibody (NBP1-86545). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD163L1 Antibody (NBP1-86545)

Discover more about diseases related to CD163L1 Antibody (NBP1-86545).

Blogs on CD163L1

There are no specific blogs for CD163L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD163L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD163L1