CD163L1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD163L1 Antibody [NBP1-86545] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: CD163L1 Antibody [NBP1-86545] - Staining of human lymph node shows strong cytoplasmic positivity in non - germinal center cells.

Analysis in human spleen tissue.

Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Analysis in human spleen and skeletal muscle tissues Corresponding CD163L1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD163L1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD163L1 Antibody - BSA Free (NBP1-86545) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD163L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CD163L1 Protein (NBP1-86545PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CD163L1 Antibody - BSA Free

• CD163 antigen B
• CD163 antigen-like 1
• CD163 molecule-like 1
• CD163B
• M160
• scavenger receptor cysteine-rich type 1 protein M160
• UNQ6434/PRO23202

Background

The CD163L1 gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family aresecreted or membrane-anchored proteins mainly found in cells associated with the immune system. The SRCR family isdefined by a 100-110 amino a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD163L1