CD109 Recombinant Protein Antigen

Images

 
There are currently no images for CD109 Recombinant Protein Antigen (NBP2-62598PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD109 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD109.

Source: E. coli

Amino Acid Sequence: GPVEILTTVTESVTGISRNVSTNVFFKQHDYIIEFFDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINYTVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD109
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62598.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD109 Recombinant Protein Antigen

  • 150 kDa TGF-beta-1-binding protein
  • activated T-cell marker CD109
  • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 7
  • CD109 antigen (Gov platelet alloantigens)
  • CD109 antigen
  • CD109 molecule
  • CD109
  • CPAMD7
  • CPAMD7r150
  • DKFZp762L1111
  • FLJ38569
  • FLJ41966
  • Gov platelet alloantigens
  • p180
  • Platelet-specific Gov antigen
  • RP11-525G3.1

Background

CD109 is a GPI-linked cell surface antigen expressed by CD34+ acute myeloid leukemia cell lines, T-cell lines, activated T lymphoblasts, endothelial cells, and activated platelets (Lin et al., 2002 [PubMed 11861284]). In addition, the platelet-specific Gov antigen system, implicated in refractoriness to platelet transfusion, neonatal alloimmune thrombocytopenia, and posttransfusion purpura, is carried by CD109 (Kelton et al., 1990 [PubMed 2346781]; Lin et al., 2002 [PubMed 11861284]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
H00010714-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB200-351
Species: Ha, Hu, Mu
Applications: IHC,  IHC-P, IP, WB
DRT100
Species: Hu
Applications: ELISA
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-92243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PLA, WB
NBP2-02148
Species: Hu
Applications: Flow, ICC/IF, WB
NBP1-85085
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P

Publications for CD109 Recombinant Protein Antigen (NBP2-62598PEP) (0)

There are no publications for CD109 Recombinant Protein Antigen (NBP2-62598PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD109 Recombinant Protein Antigen (NBP2-62598PEP) (0)

There are no reviews for CD109 Recombinant Protein Antigen (NBP2-62598PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD109 Recombinant Protein Antigen (NBP2-62598PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD109 Products

Research Areas for CD109 Recombinant Protein Antigen (NBP2-62598PEP)

Find related products by research area.

Blogs on CD109

There are no specific blogs for CD109, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD109 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD109