CCT5 Antibody - BSA Free

Western Blot: CCT5 Antibody [NBP1-83043] - Analysis using Anti-CCT5 antibody NBP1-83043 (A) shows similar pattern to independent antibody NBP1-83042 (B).

Immunohistochemistry-Paraffin: CCT5 Antibody [NBP1-83043] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: CCT5 Antibody [NBP1-83043] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: CCT5 Antibody [NBP1-83043] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: CCT5 Antibody [NBP1-83043] - Staining in human testis and liver tissues using anti-CCT5 antibody. Corresponding CCT5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CCT5 Antibody [NBP1-83043] - Staining of human cerebral cortex, colon, liver and testis using Anti-CCT5 antibody NBP1-83043 (A) shows similar protein distribution across tissues to independent antibody NBP1-83042 (B).

Immunohistochemistry-Paraffin: CCT5 Antibody [NBP1-83043] - Staining of human colon.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCT5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CCT5 Antibody - BSA Free (NBP1-83043) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQM
• Predicted Species: Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCT5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CCT5 Protein (NBP1-83043PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CCT5 Antibody - BSA Free

• chaperonin containing TCP1, subunit 5 (epsilon)
• epsilon subunit

Background

CCT5 encodes a molecular chaperone that is member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCT5