CCT5 Antibody

Images

 
Western Blot: CCT5 Antibody [NBP1-83042] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CCT5 Antibody [NBP1-83042] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: CCT5 Antibody [NBP1-83042] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: CCT5 Antibody [NBP1-83042] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCT5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCT5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCT5 Protein (NBP1-83042PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCT5 Antibody

  • chaperonin containing TCP1, subunit 5 (epsilon)
  • epsilon subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88145
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97505
Species: Hu, Mu, Rt, Po, Bv, Ce, Ca, Dr, GP, Pl, Pm, Rb, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88146
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-88144
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33583
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009468-D01P
Species: Hu
Applications: WB, ELISA
NBP1-88285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-97491
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-30036
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for CCT5 Antibody (NBP1-83042) (0)

There are no publications for CCT5 Antibody (NBP1-83042).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCT5 Antibody (NBP1-83042) (0)

There are no reviews for CCT5 Antibody (NBP1-83042). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCT5 Antibody (NBP1-83042) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCT5 Products

Bioinformatics Tool for CCT5 Antibody (NBP1-83042)

Discover related pathways, diseases and genes to CCT5 Antibody (NBP1-83042). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCT5 Antibody (NBP1-83042)

Discover more about diseases related to CCT5 Antibody (NBP1-83042).
 

Pathways for CCT5 Antibody (NBP1-83042)

View related products by pathway.

Research Areas for CCT5 Antibody (NBP1-83042)

Find related products by research area.

Blogs on CCT5

There are no specific blogs for CCT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCT5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCT5