CCL14/HCC-1/HCC-3 Antibody (3B12)

Product Discontinued

CCL14/HCC-1/HCC-3 Antibody (3B12) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CCL14 (AAH45165, 20 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
• Specificity: chemokine (C-C motif) ligand 14
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CCL14
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL14/HCC-1/HCC-3 Antibody (3B12)

• C-C motif chemokine 14
• CCL14
• chemokine (C-C motif) ligand 14
• Chemokine CC-1/CC-3
• chemokine CC-3
• CKB1
• FLJ16015
• HCC-1
• HCC-1(1-74)
• HCC-1/HCC-3
• HCC-3
• hemofiltrate CC chemokine 1
• MCIF
• member 14
• NCC2CC-1
• NCC-2CKb1
• new CC chemokine 2
• SCYA14CC-3
• Small-inducible cytokine A14

Background

This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. This gene expresses both monocistronic and bicistronic transcripts. Bicistronic transcripts include the upstream cytokine gene CCL15. In addition, CCL14 undergoes alternative splicing in the bicistronic transcripts; it is unknown if its monocistronic transcript is also subject to alternative splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCL14
• Entrez:
  • 6358(Human)
• OMIM:
  • 601392(Human)
• Uniprot:
  • AAH45165(Human)