CCL14/HCC-1/HCC-3 Antibody (3B12)

Images

 
There are currently no images for CCL14/HCC-1/HCC-3 Antibody (H00006358-M04).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3B12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CCL14/HCC-1/HCC-3 Antibody (3B12) Summary

Immunogen
CCL14 (AAH45165, 20 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Specificity
chemokine (C-C motif) ligand 14
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CCL14
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL14/HCC-1/HCC-3 Antibody (3B12)

  • C-C motif chemokine 14
  • CCL14
  • chemokine (C-C motif) ligand 14
  • Chemokine CC-1/CC-3
  • chemokine CC-3
  • CKB1
  • FLJ16015
  • HCC-1
  • HCC-1(1-74)
  • HCC-1/HCC-3
  • HCC-3
  • hemofiltrate CC chemokine 1
  • MCIF
  • member 14
  • NCC2CC-1
  • NCC-2CKb1
  • new CC chemokine 2
  • SCYA14CC-3
  • Small-inducible cytokine A14

Background

This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. This gene expresses both monocistronic and bicistronic transcripts. Bicistronic transcripts include the upstream cytokine gene CCL15. In addition, CCL14 undergoes alternative splicing in the bicistronic transcripts; it is unknown if its monocistronic transcript is also subject to alternative splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB363
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB145
Species: Hu
Applications: Flow, CyTOF-ready
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB328
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-46256
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45937
Species: Hu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-32914
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC

Publications for CCL14/HCC-1/HCC-3 Antibody (H00006358-M04) (0)

There are no publications for CCL14/HCC-1/HCC-3 Antibody (H00006358-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCL14/HCC-1/HCC-3 Antibody (H00006358-M04) (0)

There are no reviews for CCL14/HCC-1/HCC-3 Antibody (H00006358-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCL14/HCC-1/HCC-3 Antibody (H00006358-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CCL14/HCC-1/HCC-3 Products

Bioinformatics Tool for CCL14/HCC-1/HCC-3 Antibody (H00006358-M04)

Discover related pathways, diseases and genes to CCL14/HCC-1/HCC-3 Antibody (H00006358-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCL14/HCC-1/HCC-3 Antibody (H00006358-M04)

Discover more about diseases related to CCL14/HCC-1/HCC-3 Antibody (H00006358-M04).
 

Pathways for CCL14/HCC-1/HCC-3 Antibody (H00006358-M04)

View related products by pathway.

PTMs for CCL14/HCC-1/HCC-3 Antibody (H00006358-M04)

Learn more about PTMs related to CCL14/HCC-1/HCC-3 Antibody (H00006358-M04).
 

Research Areas for CCL14/HCC-1/HCC-3 Antibody (H00006358-M04)

Find related products by research area.

Blogs on CCL14/HCC-1/HCC-3

There are no specific blogs for CCL14/HCC-1/HCC-3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCL14/HCC-1/HCC-3 Antibody (3B12) and receive a gift card or discount.

Bioinformatics

Gene Symbol CCL14
Entrez
OMIM
Uniprot