CCL13/MCP-4 Antibody

Images

 
Western Blot: CCL13/MCP-4 Antibody [H00006357-D01P] - Analysis of CCL13 expression in transfected 293T cell line by CCL13 polyclonal antibody.Lane 1: CCL13 transfected lysate(11.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCL13/MCP-4 Antibody Summary

Immunogen
CCL13 (NP_005399.1, 1 a.a. - 98 a.a.) full-length human protein. MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCL13
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL13/MCP-4 Antibody

  • C-C motif chemokine 13
  • CCL13
  • chemokine (C-C motif) ligand 13
  • CKb10
  • MCP4
  • MCP-4
  • MCP-4Monocyte chemoattractant protein 4
  • MGC17134
  • NCC-1Monocyte chemotactic protein 4
  • NCC1Small-inducible cytokine A13
  • new CC chemokine 1
  • SCYA13CK-beta-10
  • SCYL1
  • small inducible cytokine subfamily A (Cys-Cys), member 13

Background

This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
AF7177
Species: Hu
Applications: WB, ICC
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-48337
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB330
Species: Hu
Applications: Flow, IHC, CyTOF-reported, Neut
MAB653
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00006357-D01P
Species: Hu
Applications: WB

Publications for CCL13/MCP-4 Antibody (H00006357-D01P) (0)

There are no publications for CCL13/MCP-4 Antibody (H00006357-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCL13/MCP-4 Antibody (H00006357-D01P) (0)

There are no reviews for CCL13/MCP-4 Antibody (H00006357-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCL13/MCP-4 Antibody (H00006357-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCL13/MCP-4 Products

Bioinformatics Tool for CCL13/MCP-4 Antibody (H00006357-D01P)

Discover related pathways, diseases and genes to CCL13/MCP-4 Antibody (H00006357-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCL13/MCP-4 Antibody (H00006357-D01P)

Discover more about diseases related to CCL13/MCP-4 Antibody (H00006357-D01P).
 

Pathways for CCL13/MCP-4 Antibody (H00006357-D01P)

View related products by pathway.

PTMs for CCL13/MCP-4 Antibody (H00006357-D01P)

Learn more about PTMs related to CCL13/MCP-4 Antibody (H00006357-D01P).
 

Research Areas for CCL13/MCP-4 Antibody (H00006357-D01P)

Find related products by research area.

Blogs on CCL13/MCP-4

There are no specific blogs for CCL13/MCP-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCL13/MCP-4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCL13
Entrez
Uniprot