Home » CCL13/MCP-4 » CCL13/MCP-4 Antibodies » CCL13/MCP-4 Antibody (S2)

CCL13/MCP-4 Antibody (S2)

 Submit a Review

Images

 
There are currently no images for CCL13/MCP-4 Antibody (H00006357-M03).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
S2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CCL13/MCP-4 Antibody (S2) Summary

Immunogen
CCL13 (AAH08621, 1 a.a. - 98 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Specificity
CCL13 - chemokine (C-C motif) ligand 13 (S2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CCL13
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL13/MCP-4 Antibody (S2)

  • C-C motif chemokine 13
  • CCL13
  • chemokine (C-C motif) ligand 13
  • CKb10
  • MCP4
  • MCP-4
  • MCP-4Monocyte chemoattractant protein 4
  • MGC17134
  • NCC-1Monocyte chemotactic protein 4
  • NCC1Small-inducible cytokine A13
  • new CC chemokine 1
  • SCYA13CK-beta-10
  • SCYL1
  • small inducible cytokine subfamily A (Cys-Cys), member 13

Background

This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CCR3 Antibody
(61828)
MAB155
CCR3 was detected in immersion fixed paraffin-embedded sections of human lymph node using 15 µg/mL Rat Anti-Human CCR3 Monoclonal Antibody (Catalog # MAB155) overnight at 4 °C. Tissue was stained with the Anti-Rat HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS018) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human CCL11/Eotaxin (Catalog # 320‑EO) chemoattracts the BaF3 mouse proB cell line transfected with human CCR3 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant CCL11/Eotaxin (0.333 μg/mL) is neutralized (green line) by increasing concentrations of Rat Anti-Human CCR3 Monoclonal Antibody (Catalog # MAB155). The ND50 is typically 0.05-0.25 µg/mL.
(17 Publications)
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(507 Publications)
Species: Hu
CapG Antibody
NBP1-90215
Western Blot: CapG Antibody [NBP1-90215] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CapG Antibody [NBP1-90215] - Staining of human skeletal muscle shows low expression as expected.
Western Blot: CapG Antibody [NBP1-90215] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
CD46 Antibody
(344519)
MAB2005
CD46 Antibody (344519)
(1 Review)
(3 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready
IL-4 [Unconjugated]
204-IL
1 μg/lane of Recombinant Human IL-4 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-4 (Catalog # 204-IL) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.05-02 ng/mL.
(8 Reviews)
(283 Publications)
Species: Hu
CCR2 Antibody
(48607) [Unconjugated
MAB150
CCR2 was detected in immersion fixed paraffin-embedded sections of human tonsil using Mouse Anti-Human CCR2 Monoclonal Antibody (Catalog # MAB150) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Human peripheral blood monocytes were stained with Mouse Anti-Human CD14 PE‑conjugated Monoclonal Antibody (Catalog # FAB3832P) and either (A) Mouse Anti-Human CCR2 Monoclonal Antibody (Catalog # MAB150) or (B) Mouse IgG2B Flow Cytometry Isotype Control (Catalog # MAB0041) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). View our protocol for Staining Membrane-associated Proteins.
(32 Publications)
Species: Hu
Applications: Flow, IHC, CyTOF-ready
CCR5 Antibody
(45531) [Unconjugated
MAB182
CCR5 was detected in immersion fixed human dendritic cells using Human CCR5 Monoclonal Antibody (Catalog # MAB182) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Human peripheral blood mononuclear cells (PBMCs) were stained with either (A) Mouse Anti-Human CCR5 Monoclonal Antibody (Catalog # MAB182) or (B) Mouse IgG2B Isotype Control (Catalog # MAB0041) followed by Goat anti-Mouse IgG APC-conjugated Secondary Antibody (Catalog # F0101B) and Mouse Anti-Human CD3 epsilon PE-conjugated Monoclonal Antibody (Catalog # FAB100P). View our protocol for Staining Membrane-associated Proteins.
Recombinant Human CCL3/MIP‑1 alpha (Catalog # 270-LD) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CCR5 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human CCL3/MIP‑1 alpha (40 ng/mL) is neutralized (green line) by increasing concentrations of Human CCR5 Monoclonal Antibody (Catalog # MAB182). The ND50 is typically 5-20 µg/mL.
(22 Publications)
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
CXCR1/IL-8 RA
Antibody (42705) [Unc ...
MAB330
CXCR1/IL‑8 RA was detected in immersion fixed paraffin-embedded sections of human endometrial cancer tissue using Mouse Anti-Human CXCR1/IL‑8 RA Monoclonal Antibody (Catalog # MAB330) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Human peripheral blood granulocytes were stained with Mouse Anti-HumanCXCR1/IL‑8 RA Monoclonal Antibody (Catalog # MAB330, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B).
CXCR1/IL‑8 RA was detected in immersion fixed frozen sections of human lymph nodes using Mouse Anti-Human CXCR1/IL‑8 RA Monoclonal Antibody (Catalog # MAB330) at 15 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to lymphocytes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(2 Reviews)
(31 Publications)
Species: Hu
Applications: Flow, IHC, CyTOF-reported, Neut

Publications for CCL13/MCP-4 Antibody (H00006357-M03) (0)

There are no publications for CCL13/MCP-4 Antibody (H00006357-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCL13/MCP-4 Antibody (H00006357-M03) (0)

There are no reviews for CCL13/MCP-4 Antibody (H00006357-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCL13/MCP-4 Antibody (H00006357-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CCL13/MCP-4 Antibody (H00006357-M03)

Discover related pathways, diseases and genes to CCL13/MCP-4 Antibody (H00006357-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCL13/MCP-4 Antibody (H00006357-M03)

Discover more about diseases related to CCL13/MCP-4 Antibody (H00006357-M03).
 

Pathways for CCL13/MCP-4 Antibody (H00006357-M03)

View related products by pathway.

PTMs for CCL13/MCP-4 Antibody (H00006357-M03)

Learn more about PTMs related to CCL13/MCP-4 Antibody (H00006357-M03).
 

Research Areas for CCL13/MCP-4 Antibody (H00006357-M03)

Find related products by research area.

Blogs on CCL13/MCP-4

There are no specific blogs for CCL13/MCP-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCL13/MCP-4 Antibody (S2) and receive a gift card or discount.


Bioinformatics

Gene Symbol CCL13
Entrez
Uniprot