Home » CCDC85A » CCDC85A Antibodies » CCDC85A Antibody

CCDC85A Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry: CCDC85A Antibody [NBP2-49241] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry: CCDC85A Antibody [NBP2-49241] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CCDC85A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DDDRQKGKRVSREWQRLGRYTAGVMHKEVALYLQKLKDLEVKQEEVVKENMELKELCVLLDEEKGAGCAGSRCSI
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC85A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC85A Recombinant Protein Antigen (NBP2-49241PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC85A Antibody

  • coiled-coil domain containing 85A
  • coiled-coil domain-containing protein 85A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ASB3 Antibody
NB100-56645
Western Blot: ASB3 Antibody [NB100-56645] - Western blot analysis of ASB3 in 15 ugs of human spleen cell lysate using NB100-56645 at 1:1000 dilution.
Species: Hu, Mu(-), Rt(-)
Applications: WB
Dexras1 Antibody
NBP1-91830
Western Blot: Dexras1 Antibody [NBP1-91830] - Analysis in control (vector only transfected HEK293T lysate) and RASD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CaMKII beta
Antibody
NB120-22131
Western Blot: CaMKII beta Antibody [NB120-22131] - Analysis of CAMKII beta in A) human, B) mouse and C) rat brain lysate using CAMKII beta antibody at 1:2000.
Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NB120-22131] - Staining of CAMKIIb using NB120-22131 in rat hippocampal neurons at a dilution of 1:100, note that staining is rather weak.
Western Blot: CaMKII beta Antibody [NB120-22131] - Analysis of CAMKIIb in rat brain lysate using NB120-22131 at 1:2000.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Ikaros/IKZF1
Antibody [Unconjugate
AF4984
Western blot shows lysates of Nalm‑6 human Pre‑B acute lymphocytic leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Bands were detected for Ikaros (1-8 spice forms) at approximately 37 to 63 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Jurkat human acute T cell leukemia cell line treated with 50 ng/mL PMA and 200 ng/mL calcium ionomycin for 30 minutes was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Ikaros/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The VPAC promoter was detected by standard PCR.
Simple Western lane view shows lysates of Nalm‑6 human Pre-B acute lymphocytic leukemia cell line, loaded at 0.2 mg/mL. Specific bands were detected for Ikaros at approximately 63-77 kDa (as indicated) using 10 µg/mL of Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(2 Publications)
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBR1 Antibody -
BSA Free
NBP1-71703
Western Blot: NBR1 Antibody [NBP1-71703] - WB analysis of NBR1 in HepG2 cell lysates.
Immunocytochemistry/Immunofluorescence: NBR1 Antibody [NBP1-71703] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with NBR1 Antibody (NBP1-71703) at 1 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Simple Western: NBR1 Antibody [NBP1-71703] - Simple Western lane view shows a specific band for NBR1 in 0.5 mg/ml of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(2 Reviews)
(7 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
delta-Sarcoglycan
Antibody (3G10)
H00006444-M01-100ug
Immunocytochemistry/Immunofluorescence: delta Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Mouse Skeletal Muscle stained by verified customer.
Western Blot: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Western Blot detection against Immunogen (34.1 KDa) .
ELISA: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Detection limit for recombinant GST tagged SGCD is 0.03 ng/ml as a capture antibody.
(1 Review)
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Serpin F1/PEDF
[Biotin]
DY1177-05
(14 Publications)
Species: Hu
Applications: ELISA
MKK3/MEK3 Antibody
(2E12D11) - BSA Free
NBP2-52508
ELISA: MKK3/MEK3 Antibody (2E12D11) [NBP2-52508] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng).
Flow Cytometry: MKK3/MEK3 Antibody (2E12D11) [NBP2-52508] - Analysis of Hela cells using MAP2K3 mouse mAb (green) and negative control (red).
Immunofluorescence: MKK3/MEK3 Antibody (2E12D11) [NBP2-52508] - Analysis of GC-7901 cells using MAP2K3 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IF, IHC, IHC-P, WB
Neurofibromin 1
Antibody
NB300-155
Immunohistochemistry: Neurofibromin 1 Antibody [NB300-155] - NF1 protein labeling displays positive signal in the maturing and the hypertrophic cartilages but only faint labeling in the proliferative cartilage.
Western Blot: Neurofibromin 1 Antibody [NB300-155] - Western Blot of (A, B, C above).
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MOX1 Antibody
(OTI5B11)
NBP2-45819
Immunohistochemistry-Paraffin: MOX1 Antibody (OTI5B11) [NBP2-45819] - Analysis of Human lymph node tissue. Image from verified customer review.
Immunohistochemistry: MOX1 Antibody (5B11) [NBP2-45819] - Analysis of Human lymph node tissue.
Western Blot: MOX1 Antibody (5B11) [NBP2-45819] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MOX1.
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
RASL10B Antibody
NBP2-13205
Immunohistochemistry-Paraffin: RASL10B Antibody [NBP2-13205] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: RASL10B Antibody [NBP2-13205] - Staining in human skeletal muscle and tonsil tissues using anti-RASL10B antibody. Corresponding RASL10B RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RASL10B Antibody [NBP2-13205] - Staining of human tonsil shows low expression as expected.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Neurexophilin-3
Antibody [Unconjugate
AF5098
Western blot shows lysates of human brain (cerebellum) tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat Neurexophilin‑3/NXPH‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5098) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Neurexophilin‑3/NXPH‑3 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
IGFBP-4 Antibody
NBP1-80549
Immunocytochemistry/Immunofluorescence: IGFBP-4 Antibody [NBP1-80549] - Mouse uterus stained with at a dilution of 1:1000. HIER is applied using citrate buffer pH6. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: IGFBP-4 Antibody [NBP1-80549] - Rac1 regulates vesicular exocytosis in decidual cells by controlling Rab27b. Secretions by decidual cells are reduced in the conditioned media of Rac1-null stromal cells. Stromal cells isolated from Rac1f/f and Rac1d/d uteri on day 4 of pregnancy were cultured for 96 hours, fixed and subjected to IF using IGFBP4 (Left) antibody. Conditioned media from cultured stromal cells isolated from Rac1f/f and Rac1d/d uteri were analyzed for IGFBP4 (Right) by ELISA. Data represent mean +/- SEM from three separate samples and were analyzed by two-way ANOVA with Bonferroni post-test. Asterisks indicate statistically significant differences (*P < 0.05, **P < 0.01, and ***P < 0.001). Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1005458), licensed under a CC-BY licence.
Western Blot: IGFBP-4 Antibody [NBP1-80549] - Host: Rabbit. Target Name: IGFBP4. Sample Tissue: Human MDA-MB-435s Whole Cell. Antibody Dilution: 1ug/ml
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Recombinant Human
HOXB5 GST (N-Term) Pr ...
H00003215-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
(2 Publications)
Species: Hu
Applications: ELISA, AP, PA, WB
Integrin alpha
3/CD49c Antibody [Unc ...
AF2787
Integrin alpha 3/CD49c Antibody [Unconjugated]
(6 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, WB
TRAP220/MED1
Antibody
AF5520
Western blot shows lysates of 293T human embryonic kidney cell line and HeLa human cervical epithelial carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse TRAP220 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5520) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for TRAP220 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 5.
(1 Review)
Species: Hu, Mu
Applications: WB
BAF57 Antibody
NBP1-90012
Immunocytochemistry/Immunofluorescence: BAF57 Antibody [NBP1-90012] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: BAF57 Antibody [NBP1-90012] - Staining of human endometrium shows high expression.
Immunohistochemistry-Paraffin: BAF57 Antibody [NBP1-90012] - Staining of human liver shows low expression as expected.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PCYT1A Antibody
NBP1-84366
Immunocytochemistry/Immunofluorescence: PCYT1A Antibody [NBP1-84366] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Western Blot: PCYT1A Antibody [NBP1-84366] - Analysis in human cell line EFO-21.
Immunohistochemistry-Paraffin: PCYT1A Antibody [NBP1-84366] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
gamma Catenin
Antibody (4C12)
NBP2-37557
ELISA: gamma Catenin Antibody (4C12) [NBP2-37557] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: gamma Catenin Antibody (4C12) [NBP2-37557] - Western blot analysis using JUP mAb against human JUP (AA: 534-740) recombinant protein. (Expected MW is 48.5 kDa)
Western Blot: gamma Catenin Antibody (4C12) [NBP2-37557] - Western blot analysis using JUP mouse mAb against T47D (1), MCF-7 (2), SKBR-3 (3), A431 (4) and HEK293 (5) cell lysate.
(2 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
CCDC85A Antibody
NBP2-49241
CCDC85A Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for CCDC85A Antibody (NBP2-49241) (0)

There are no publications for CCDC85A Antibody (NBP2-49241).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC85A Antibody (NBP2-49241) (0)

There are no reviews for CCDC85A Antibody (NBP2-49241). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCDC85A Antibody (NBP2-49241) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC85A Products

Bioinformatics Tool for CCDC85A Antibody (NBP2-49241)

Discover related pathways, diseases and genes to CCDC85A Antibody (NBP2-49241). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC85A Antibody (NBP2-49241)

Discover more about diseases related to CCDC85A Antibody (NBP2-49241).

Blogs on CCDC85A

There are no specific blogs for CCDC85A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC85A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CCDC85A