CCDC85A Antibody

Images

 
Immunohistochemistry: CCDC85A Antibody [NBP2-49241] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC85A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DDDRQKGKRVSREWQRLGRYTAGVMHKEVALYLQKLKDLEVKQEEVVKENMELKELCVLLDEEKGAGCAGSRCSI
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC85A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC85A Recombinant Protein Antigen (NBP2-49241PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC85A Antibody

  • coiled-coil domain containing 85A
  • coiled-coil domain-containing protein 85A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56645
Species: Hu, Mu(-), Rt(-)
Applications: WB
NBP1-91830
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB120-22131
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP1-71703
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
H00006444-M01-100ug
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
DY1177-05
Species: Hu
Applications: ELISA
NBP2-52508
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IF, IHC, IHC-P, WB
NB300-155
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-45819
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-13205
Species: Hu
Applications: IHC, IHC-P
AF5098
Species: Hu, Mu, Rt
Applications: WB
NBP1-80549
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00003215-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
AF2787
Species: Mu
Applications: CyTOF-ready, Flow, WB
AF5520
Species: Hu, Mu
Applications: WB
NBP1-90012
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84366
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37557
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-49241
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for CCDC85A Antibody (NBP2-49241) (0)

There are no publications for CCDC85A Antibody (NBP2-49241).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC85A Antibody (NBP2-49241) (0)

There are no reviews for CCDC85A Antibody (NBP2-49241). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCDC85A Antibody (NBP2-49241) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC85A Products

Bioinformatics Tool for CCDC85A Antibody (NBP2-49241)

Discover related pathways, diseases and genes to CCDC85A Antibody (NBP2-49241). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC85A Antibody (NBP2-49241)

Discover more about diseases related to CCDC85A Antibody (NBP2-49241).

Blogs on CCDC85A

There are no specific blogs for CCDC85A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC85A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC85A