Recombinant Human CCDC6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CCDC6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 375-474 of Human CCDC6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CCDC6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CCDC6 Protein

  • coiled-coil domain containing 6
  • D10S170Protein H4
  • H4DNA segment on chromosome 10 (unique) 170
  • Papillary thyroid carcinoma-encoded protein
  • PTCFLJ32286
  • TPCcoiled-coil domain-containing protein 6
  • TST1

Background

CCDC6 - coiled-coil domain containing 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP1-58095
Species: Hu
Applications: WB
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00008030-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CCDC6 Partial Recombinant Protein (H00008030-Q01) (0)

There are no publications for CCDC6 Partial Recombinant Protein (H00008030-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC6 Partial Recombinant Protein (H00008030-Q01) (0)

There are no reviews for CCDC6 Partial Recombinant Protein (H00008030-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC6 Partial Recombinant Protein (H00008030-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCDC6 Products

Bioinformatics Tool for CCDC6 Partial Recombinant Protein (H00008030-Q01)

Discover related pathways, diseases and genes to CCDC6 Partial Recombinant Protein (H00008030-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC6 Partial Recombinant Protein (H00008030-Q01)

Discover more about diseases related to CCDC6 Partial Recombinant Protein (H00008030-Q01).
 

Pathways for CCDC6 Partial Recombinant Protein (H00008030-Q01)

View related products by pathway.

PTMs for CCDC6 Partial Recombinant Protein (H00008030-Q01)

Learn more about PTMs related to CCDC6 Partial Recombinant Protein (H00008030-Q01).

Blogs on CCDC6.

The role of Smoothened in pulmonary pathologies
The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche...  Read full blog post.

Customers Who Bought This Also Bought

CCDC6 Antibody
NBP1-85351

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CCDC6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC6