CCDC39 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining in human testis and tonsil tissues.. Corresponding CCDC39 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human bronchus, fallopian tube, rectum and tonsil using Anti-CCDC39 antibody NBP1-90560 (A) shows similar protein ...read more
Western Blot: CCDC39 Antibody [NBP1-90560] - Analysis in human cell line RPMI-8226.
Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human rectum shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human testis shows strong cytoplasmic positivity in spermatozoa.
Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human bronchus shows strong positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC39 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ILDNELTETISAQLELDKAAQDFRKIHNERQELIKQWENTIEQMQKRDGDIDNCALELARIKQETREKENLVKEKIKFLESEIGNNTEFEKRISVADR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC39
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC39 Protein (NBP1-90560PEP)
Publications
Read Publications using NBP1-90560.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%). Reactivity reported in scientific literature (PMID: 23872636).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC39 Antibody

  • coiled-coil domain containing 39

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16669
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88502
Species: Hu
Applications: IHC, IHC-P
NBP1-82162
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3715
Species: Hu
Applications: IHC, IP, KO, Simple Western, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83192
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-49883
Species: Bv, Ca, Hu, Mu, RM
Applications: IHC, IHC-P, PEP-ELISA
NBP1-84466
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-83552
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00003703-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP1-81858
Species: Hu
Applications: IHC, IHC-P, WB
NB110-40579
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-80104
Species: Hu
Applications: WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
NBP1-90560
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CCDC39 Antibody (NBP1-90560)(2)

Reviews for CCDC39 Antibody (NBP1-90560) (0)

There are no reviews for CCDC39 Antibody (NBP1-90560). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC39 Antibody (NBP1-90560). (Showing 1 - 1 of 1 FAQs).

  1. I would like to find an antibody for IHC that detects only human CCDC39 without detecting mouse CCDC39 (without or minimal cross-reactivity to mouse). There fore can you tell me the percentage between the immunogen and the mouse protein? NBP1-90560 and NBP2-33999
    • For NBP1-90560 the identity between the immunogen and the mouse sequence is 78.5%, which is pretty low and we would not expect there to be cross-reactivity but this has not been tested. For NBP2-33999 the identity is 84%, so it may or may not cross react but again it has not been tested, so we can not guarantee that either of these product will not react with mouse samples. Although if you wanted to try, NBP1-90560 would be a better choice.

Secondary Antibodies

 

Isotype Controls

Additional CCDC39 Products

Bioinformatics Tool for CCDC39 Antibody (NBP1-90560)

Discover related pathways, diseases and genes to CCDC39 Antibody (NBP1-90560). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC39 Antibody (NBP1-90560)

Discover more about diseases related to CCDC39 Antibody (NBP1-90560).

Blogs on CCDC39

There are no specific blogs for CCDC39, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC39 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC39