CCDC39 Antibody

Images

 
Western Blot: CCDC39 Antibody [NBP1-90560] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-108
Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human bronchus shows strong positivity in cilia of respiratory epithelial cells.
Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC39 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILDNELTETISAQLELDKAAQDFRKIHNERQELIKQWENTIEQMQKRDGDIDNCALELARIKQETREKENLVKEKIKFLESEIGNNTEFEKRISVADR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC39
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC39 Protein (NBP1-90560PEP)
Publications
Read Publications using NBP1-90560.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%). Reactivity reported in scientific literature (PMID: 23872636)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC39 Antibody

  • coiled-coil domain containing 39

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16669
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002191-M01
Species: Hu
Applications: WB, ELISA, IP
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-49883
Species: Hu, Mu, Bv, Ca, Mk, Rb
Applications: IHC, IHC-P, PEP-ELISA
NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NB110-40579
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80104
Species: Hu
Applications: WB
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-90560
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CCDC39 Antibody (NBP1-90560)(2)

Reviews for CCDC39 Antibody (NBP1-90560) (0)

There are no reviews for CCDC39 Antibody (NBP1-90560). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC39 Antibody (NBP1-90560) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC39 Products

Bioinformatics Tool for CCDC39 Antibody (NBP1-90560)

Discover related pathways, diseases and genes to CCDC39 Antibody (NBP1-90560). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC39 Antibody (NBP1-90560)

Discover more about diseases related to CCDC39 Antibody (NBP1-90560).

Blogs on CCDC39

There are no specific blogs for CCDC39, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC39 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC39