CCDC39 Antibody - BSA Free

Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining in human testis and tonsil tissues.. Corresponding CCDC39 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human bronchus, fallopian tube, rectum and tonsil using Anti-CCDC39 antibody NBP1-90560 (A) shows similar protein distribution across tissues to independent antibody NBP2-33999 (B).

Western Blot: CCDC39 Antibody [NBP1-90560] - Analysis in human cell line RPMI-8226.

Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human rectum shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human testis shows strong cytoplasmic positivity in spermatozoa.

Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human fallopian tube shows strong positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human bronchus shows strong positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: CCDC39 Antibody [NBP1-90560] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCDC39 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILDNELTETISAQLELDKAAQDFRKIHNERQELIKQWENTIEQMQKRDGDIDNCALELARIKQETREKENLVKEKIKFLESEIGNNTEFEKRISVADR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCDC39
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CCDC39 Protein (NBP1-90560PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%). Reactivity reported in scientific literature (PMID: 23872636).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CCDC39 Antibody - BSA Free

• coiled-coil domain containing 39

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC39 Antibody (NBP1-90560)(2)

Publications using NBP1-90560

• Tarkar A, Loges NT, Slagle CE et al. DYX1C1 is required for axonemal dynein assembly and ciliary motility. Nat Genet 2013-09-01 [PMID: 23872636]
• Merveille AC, Davis EE, Becker-Heck A et al. CCDC39 is required for assembly of inner dynein arms and the dynein regulatory complex and for normal ciliary motility in humans and dogs. Nat Genet 2011-01-01 [PMID: 21131972]

FAQs for CCDC39 Antibody (NBP1-90560). (Showing 1 - 1 of 1 FAQs).

1. I would like to find an antibody for IHC that detects only human CCDC39 without detecting mouse CCDC39 (without or minimal cross-reactivity to mouse). There fore can you tell me the percentage between the immunogen and the mouse protein? NBP1-90560 and NBP2-33999
   • For NBP1-90560 the identity between the immunogen and the mouse sequence is 78.5%, which is pretty low and we would not expect there to be cross-reactivity but this has not been tested. For NBP2-33999 the identity is 84%, so it may or may not cross react but again it has not been tested, so we can not guarantee that either of these product will not react with mouse samples. Although if you wanted to try, NBP1-90560 would be a better choice.

Bioinformatics

• Gene Symbol: CCDC39